KEGG   Borreliella bissettii: BbiDN127_0643Help
Entry
BbiDN127_0643     CDS       T01593                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bbs  Borreliella bissettii
Pathway
bbs03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BbiDN127_0643 (recD)
Enzymes [BR:bbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BbiDN127_0643 (recD)
DNA repair and recombination proteins [BR:bbs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BbiDN127_0643 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 AAA_11 Viral_helicase1 UvrD_C_2 Helicase_RecD DUF2075 T2SSE AAA_22 RsgA_GTPase AAA_16 PhoH AAA RNA_helicase AAA_5 AAA_24 TrwB_AAD_bind Zeta_toxin SRP54 AAA_28 DEAD PSDC
Motif
Other DBs
NCBI-ProteinID: AEL18799
UniProt: G0AM73
Position
complement(660696..662531)
Genome map
AA seq 611 aa AA seqDB search
MRDFLVLREFLKDKSKKFLTPELKLYEIIELLNINKKNCYKAQTLAKFTNNENIAIFLIF
LFNYFDKGHLRADINLLAKDIQNTIIFTKDNLEKTNKSYNKLIKMLKELETFGNPETIKN
MVLLLKKNNILMEFNNKLKITTPLILENNIYIYTQKNYREEEELIKQIIKRLENHKNELN
DNKIQNIISTLNINNLNKEQITSVRKALKSNFFLLSGGPGTGKTTTINYILKAINKTLNN
KKKRLVAIAAPTGKASLRLQTSIDYSFKNLEIECNTIQKLLGIKFINKKNLYDEENQLNF
DVIIIDEASMVDAYTFLKLLKATPITTKLIMVGDKNQLPSVNEGNVYSSLLGIKQINNDN
VEELKENFRSNKEINLLSKAIYKEDSTLICKYINDNKNIQLKEIEKINLKKDLIEYTNNL
YKKIPTFNLKLLKESKIEIILETLLENIILSSKNFGKFGTKTLNEIIKTYLKKTYGSFIG
QIIMITKTDYKNKLFNGERGVIFNENSKFYALFQRKDEKYKKINLDLLTNYEFSFATTIH
KSQGSEYKHIKVILENNPFLTKELMYTAITRAKDSLEIISNKETIIKLSKKSSKRDSKIL
EHVNSFKEIDK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttttagtattaagagaatttttaaaagataaaagcaaaaaattcttaacc
cctgaacttaagctttatgaaataattgaacttttaaatatcaataaaaaaaattgttat
aaagcacaaacacttgcaaagttcacaaacaatgaaaatattgcaatatttttaatattt
ttatttaactattttgataaaggccacctaagagctgatataaatctattagcaaaagat
attcaaaatacaataatatttacaaaagacaacctagaaaaaaccaataaaagttacaac
aaattaataaaaatgctaaaagagttagaaacatttggaaatccagaaactattaagaat
atggttttgcttttaaaaaaaaacaacatactaatggaatttaacaataagcttaaaatt
acaactcccctaattttggaaaacaatatctacatttatactcaaaaaaactacagagaa
gaagaagagttaataaaacaaattataaaaagattagaaaaccataaaaatgaattaaat
gacaataaaatacaaaatataatatcaactttaaatatcaataatttaaataaagagcaa
attacatcagtgagaaaggcattaaaaagcaacttctttctattaagcggaggccccgga
acaggcaaaactacaactattaactatatcttaaaagcaattaacaaaacattaaacaat
aaaaaaaaaagattagtagcaattgcagcccccacaggaaaagccagcctaagactgcaa
acaagtatagactattcattcaaaaatttagaaatagaatgcaatacaatccaaaaacta
ttgggaatcaaatttataaataaaaaaaatttatatgatgaagaaaatcaattaaatttt
gacgtaataataattgacgaagcttcaatggtagacgcatatacttttttaaaactacta
aaagcaactccaataaccactaagttaataatggtaggagataaaaatcaactcccatca
gtaaacgaaggaaatgtatattcaagtcttttaggaataaaacaaataaataacgataat
gtagaagaacttaaagaaaatttcagaagcaacaaagaaataaatttgctctcaaaagca
atatacaaagaagatagcactttgatttgcaaatacattaatgacaataaaaatattcaa
ctgaaagaaatagaaaaaataaacttaaaaaaagatctaatagaatatacaaacaattta
tataaaaaaatacccacttttaatcttaaattgctaaaagaatcaaaaattgaaataata
cttgaaactttacttgaaaatataattttaagttcaaaaaattttggcaaatttggaact
aagacactaaatgaaataataaaaacttacctaaaaaagacctatggaagctttattggc
caaataataatgataactaaaactgactataaaaataaattatttaatggagaacggggt
gttatttttaatgaaaattctaaattttatgctttattccaaagaaaagatgaaaaatat
aaaaaaataaatttagatttactaacaaattatgaattcagttttgccacaacaatacac
aaaagccaaggatctgaatacaaacatataaaagtaatattagaaaataaccctttttta
acaaaagagcttatgtatactgcaataacaagggccaaggacagcttagaaataatttct
aacaaagagactattattaagctaagcaaaaaatctagcaaaagagattcaaaaatacta
gaacacgtaaactcatttaaagaaattgacaaataa

DBGET integrated database retrieval system