KEGG   Borrelia bissettii: BbiDN127_0669Help
Entry
BbiDN127_0669     CDS       T01593                                 

Gene name
gpmA
Definition
putative phosphoglycerate mutase (EC:3.1.3.13)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbs  Borrelia bissettii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BbiDN127_0669 (gpmA)
   01230 Biosynthesis of amino acids
    BbiDN127_0669 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BbiDN127_0669 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BbiDN127_0669 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BbiDN127_0669 (gpmA)
Enzymes [BR:bbs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BbiDN127_0669 (gpmA)
Exosome [BR:bbs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BbiDN127_0669 (gpmA)
  Exosomal proteins of melanoma cells
   BbiDN127_0669 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
695149..695895
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNRENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSSLSR
ANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVP
PMSLDESDDRHPIKDPRYKHIPKRELPSTECLKDTVARVIPYWTDEIAKEVLEGKKVIIA
AHGNSLRALVKYLDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDESKIKKAMES
VASQGKLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtaagacacggagagagtgagtggaatagagaaaatcttttt
actggttggacagatgttaaactttctgataaaggtatcgatgaggctgtagaggcaggt
ttacttctcaagcaagaaggttattcttttgatattgcttttagttcttcgttgtcaagg
gctaatgacactttaaatattattttgcgagagctaggtcaatcttatattagtgtaaaa
aaaacctggagattaaatgaaaggcattatggggctttgcaaggtttaaataagtcagaa
acagctgcaaaatatggggaagataaagttttaatttggagacgcagttatgatgttccc
ccaatgtctttggatgagtctgatgatcgtcaccccataaaagatccaagatataaacat
attcctaaaagggaacttccttcaacagagtgtcttaaagatactgttgcaagagttatt
ccttattggactgatgagattgcaaaagaagttcttgaaggtaaaaaagttattattgct
gctcacggtaattctttaagagcgcttgttaaatatcttgataatttaagtgaagaagat
gttttaaagcttaacattcccacaggcattcccttggtttatgaattagataaagattta
aaccccattaaacattactatttaggtgatgaaagcaaaattaaaaaggcaatggaatct
gttgctagtcaaggaaagttgaaataa

DBGET integrated database retrieval system