KEGG   Borrelia bissettii: BbiDN127_0739Help
Entry
BbiDN127_0739     CDS       T01593                                 

Gene name
pfk6
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbs  Borrelia bissettii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BbiDN127_0739 (pfk6)
   01230 Biosynthesis of amino acids
    BbiDN127_0739 (pfk6)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BbiDN127_0739 (pfk6)
   00030 Pentose phosphate pathway
    BbiDN127_0739 (pfk6)
   00051 Fructose and mannose metabolism
    BbiDN127_0739 (pfk6)
   00052 Galactose metabolism
    BbiDN127_0739 (pfk6)
  Energy metabolism
   00680 Methane metabolism
    BbiDN127_0739 (pfk6)
Enzymes [BR:bbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BbiDN127_0739 (pfk6)
Protein phosphatases and associated proteins [BR:bbs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BbiDN127_0739 (pfk6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762919..764262
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYASEGSSHFVNEKNKIKFSVYRNEDEGDKYED
VLLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVVDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFDHFPKKKDDSGNLLYEDIGLYIKDKITEYFKSKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMAGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtataggattaaaaatgaaaatttggattttaaaatagatagtttaggagaatgcaag
caaaacaatcctttgattgatttttatgctagtgagggttcttcacattttgttaatgaa
aaaaataaaatcaagtttagtgtatataggaatgaggatgagggagataagtatgaagat
gttcttttagaaaaagccggacctagagaaaaaatttattttgtgcccaggcatgttaaa
gctgctattactacttgcggtgggctttgtcccggttttaatgacgttattcgttctatt
gtgaggactttatggaaaatttatggagttcgaaatatttatggagtaaagtttggatat
caagggcttcttcctgagtcaaattcaccttttattaatcttaatccagatgttgttgat
gatattaataaatttggaggcactattcttggctcttcaaggggtggtattaaacctgtg
gaaatagttgatactttagagagaatgaacattaatatgatttttaacattggtggggat
ggtactcaaaagggatctcttcttattgccgaggagatagaaaaaagaaatttaaaaata
gcagttgtgggcattcctaaaacagtagacaatgattttatgtttgttcaaaaatctttt
ggatttgaaaccgctgtagagcaagccgttgcagctgttgctggtgctcattttgaagct
aatagtgcatataatggcattggtcttgttaaggttatgggacgagattctggttttatt
gctgctcataccgcgctttcttctaatgatgttaatttttgtttaattccggagcttgat
tttgatatagaagggcctaatggatttcttgttcatcttgaaagacgacttttagaaaaa
gaaagcttagaagagattcctcatgcagtaatattgatagcagaaggagcaggtcaaaaa
tattttgaccatttccccaaaaagaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaatcaaaaaacatacaatttact
cttaaatacattgatcctagctatattattagaagttcacctgctaatgctagtgattcg
ctttattgtgctaggcttgggtcgaatgctgtgcatgctgcaatggctggtaaaacaaaa
atgttgattagtttgtggagtacaaaatttgtgcacataccgattaagatggcagtaatt
gacagaaataaggttaatccaaatggttctttttggagagatgttctttcaagtacaggg
caaccaattagcatgaagaattaa

DBGET integrated database retrieval system