KEGG   Borrelia bissettii: BbiDN127_E0014Help
Entry
BbiDN127_E0014    CDS       T01593                                 

Definition
isochorismatase family protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bbs  Borrelia bissettii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BbiDN127_E0014
Enzymes [BR:bbs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BbiDN127_E0014
    3.5.1.-  
     BbiDN127_E0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
lp25:complement(15314..15817)
Genome map
AA seq 167 aa AA seqDB search
MINQLQNYFKNIVATKDWHCKNHVSFSNNKNGGIWPEHCVKNTWGSEFPNDLNKKRIKKV
FFKGTDQYYDSYSGFYDDYTKKKQTGLQLYLKNNSINTLFIAGLALDFCVKETILDAINL
GFQVYLITDATRSITATPELIIQELKKLNVLTCFSKDIFDSQSKLNI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaaccaacttcaaaattatttcaaaaacattgttgccaccaaggattggcattgt
aaaaatcatgtaagcttttctaataataaaaatgggggcatttggcctgagcactgcgtc
aaaaatacttggggatcagagtttcctaatgatctaaataaaaaaagaataaaaaaagtt
ttttttaaagggaccgatcaatattacgatagttacagtggattttatgatgattacact
aaaaaaaaacaaacgggccttcagctttatctgaaaaacaattcaatcaatacattgttt
atagcaggactagcattggatttttgtgtaaaagaaacaatacttgatgcaattaacttg
ggatttcaagtttatctaataacagatgctacaagaagcataacggctactcctgaatta
ataattcaggaactcaaaaaacttaatgtattaacttgcttctccaaggacatcttcgac
agccaaagtaagcttaatatataa

DBGET integrated database retrieval system