KEGG   Borrelia bissettii: BbiDN127_E0014Help
Entry
BbiDN127_E0014    CDS       T01593                                 

Definition
isochorismatase family protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bbs  Borrelia bissettii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bbs00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
lp25:complement(15314..15817)
Genome map
AA seq 167 aa AA seqDB search
MINQLQNYFKNIVATKDWHCKNHVSFSNNKNGGIWPEHCVKNTWGSEFPNDLNKKRIKKV
FFKGTDQYYDSYSGFYDDYTKKKQTGLQLYLKNNSINTLFIAGLALDFCVKETILDAINL
GFQVYLITDATRSITATPELIIQELKKLNVLTCFSKDIFDSQSKLNI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaaccaacttcaaaattatttcaaaaacattgttgccaccaaggattggcattgt
aaaaatcatgtaagcttttctaataataaaaatgggggcatttggcctgagcactgcgtc
aaaaatacttggggatcagagtttcctaatgatctaaataaaaaaagaataaaaaaagtt
ttttttaaagggaccgatcaatattacgatagttacagtggattttatgatgattacact
aaaaaaaaacaaacgggccttcagctttatctgaaaaacaattcaatcaatacattgttt
atagcaggactagcattggatttttgtgtaaaagaaacaatacttgatgcaattaacttg
ggatttcaagtttatctaataacagatgctacaagaagcataacggctactcctgaatta
ataattcaggaactcaaaaaacttaatgtattaacttgcttctccaaggacatcttcgac
agccaaagtaagcttaatatataa

DBGET integrated database retrieval system