KEGG   Bradyrhizobium sp. BTAi1: BBta_0096Help
Entry
BBta_0096         CDS       T00528                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBta_0096 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBta_0096 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBta_0096 (trpA)
Enzymes [BR:bbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBta_0096 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(103163..103987)
Genome map
AA seq 274 aa AA seqDB search
MDARFAQLKKEGRSAFVTFVMGGDPDPETSLAIVKALPQAGADIIEIGMPFTDPMADGPS
IQAAGLRALKAGMTLKKTLQLVRSFREGDAATPIVLMGYYNPIYIYGVDKFLDDAKAAGV
DGLIIVDLPPEEDTELCIPALKAGLNFIRLATPTTDDKRLPAVLANTSGFVYYVSITGIT
GAAAADSSAVGAAVARIKRHTALPVCVGFGIRTPETARAIAANADGAVVGTALVDALRAS
LDAEGRATPKTVSAVADLVAALAQGVRGAQQAAE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcgcttcgcgcagttgaagaaggaaggccgctcggcgttcgtcaccttcgtg
atgggtggcgaccccgaccctgaaacctcgctcgcgatcgtcaaggcgctgccgcaggcg
ggcgccgacatcatcgagatcggcatgccgttcaccgatccgatggccgacggtccgtcg
atccaggccgccggcctgcgcgcgctcaaggccggcatgaccttgaagaagacgctgcaa
ctggtgcgcagcttccgtgagggtgacgcagcgacgccgatcgtgctgatgggctactac
aacccgatctatatttacggcgtcgacaagttcctcgacgacgccaaggcggccggcgtc
gacggcctgatcatcgtcgatctgcccccggaggaagacaccgagctgtgcattcccgcg
ctgaaggccgggctcaacttcatccggctggcaacgcccacgaccgatgacaagcgtctg
ccggccgtgctcgcgaacacctccggcttcgtctactatgtctcgatcaccggcatcacc
ggcgcggcggcggcggattcgtccgccgtgggcgccgcggtggcgcggatcaagcggcat
acggcgctgcccgtctgcgtcggcttcggcatccgcacaccggagaccgcccgcgccatc
gcggcgaatgccgatggcgccgtggtgggcaccgctttggtcgacgcgctccgcgccagc
ctcgatgccgagggccgcgcgacgccgaagaccgtgagcgccgtcgccgatctggtcgcc
gccttggcccagggcgtgcgcggcgcgcaacaggctgcggaatag

DBGET integrated database retrieval system