KEGG   Bradyrhizobium sp. BTAi1: BBta_0097Help
Entry
BBta_0097         CDS       T00528                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00260  Glycine, serine and threonine metabolism
bbt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01130  Biosynthesis of antibiotics
bbt01230  Biosynthesis of amino acids
Module
bbt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBta_0097 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBta_0097 (trpB)
Enzymes [BR:bbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBta_0097 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABQ32398
RhizoBase: BBta_0097
UniProt: A5E8A4
Position
complement(103996..105219)
Genome map
AA seq 407 aa AA seqDB search
MTTARPNSYRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYADAKADPAFQAEMNSYRT
HYVGRPSPLYYAERLTQHLGGAKIYFKRDELNHTGSHKVNNVLGQIMLARRMGKRRIIAE
TGAGQHGVATATLCARFGLDCVVYMGAVDVERQQPNVLRMEMLGAKVVPVQSGARTLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQSVIGDETRVQMQEAEGRLPDSLVA
CIGGGSNAMGLFHPFLDDPSVEIFGVEAAGHGLTQLHAASIAGGRPGVLHGNRTYLLMDE
DGQIAEAHSISAGLDYPGIGPEHSWLFEAKRVTYLSATDDEALAAFQLLSRLEGIIPALE
PAHAIAKVMELAPKKPKEHLMVVNLCGRGDKDVPQVGEILRKRAKES
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagcacgtccaaattcctaccgcagcggtcctgacgagcgcgggcatttcggc
atcttcggcggccgcttcgtggccgaaaccctgatgccgctgatcctggatctggaaaag
gcctatgccgacgccaaggccgatccggcgttccaggccgagatgaacagctatcggacg
cattatgtcggccgtccgtcgccgctgtactacgccgaacgtctgacccagcatctcggc
ggcgccaagatctatttcaagcgcgatgagctcaatcataccggctcgcacaaggtcaac
aacgtgcttggccagatcatgctggcgcgccgcatgggcaagcggcgcatcatcgcggag
acgggtgccggccagcatggcgtcgccaccgccacgctgtgcgcccgcttcgggctggat
tgcgtggtctatatgggcgcggtcgacgtcgaacgtcagcagcccaacgtgctccgcatg
gagatgctcggcgccaaggtggtgccggtgcagtcgggtgcccgcacgctgaaggacgcg
atgaacgaggcgctgcgcgattgggtcaccaacgtccacgacacgttctactgcatcggc
acggtcgccggtccgcacccttatccgatgatggtgcgcgacttccagtcggtgatcggc
gacgagacgcgggtgcagatgcaggaggccgaaggccggctgccggactctctggtcgcc
tgcatcggcggcggctccaatgcgatgggcctgtttcatcccttcctcgacgatccctcc
gtcgagatcttcggcgtcgaagccgcaggccatggcctgacgcagctgcatgccgcgtcg
atcgccggcggccgtcccggcgtgctgcacggcaaccgcacctatctgctgatggacgag
gacggccagatcgccgaggcgcattcgatctcggccggcctcgattatcccggcatcggc
cctgagcattcctggctgttcgaagccaagcgcgtgacctatctctcggccaccgatgac
gaggcgctggcggcgttccagctgctgtcgcggctggaaggcatcatcccggcgctcgaa
ccggcgcatgccatcgccaaggtgatggagctcgcgccgaagaagccgaaggaacacctg
atggtcgtcaatctgtgcggccgcggcgacaaggacgtgccgcaggtcggtgagatcctg
cgaaagagggcgaaagagtcgtga

DBGET integrated database retrieval system