KEGG   Bradyrhizobium sp. BTAi1: BBta_0097Help
Entry
BBta_0097         CDS       T00528                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBta_0097 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBta_0097 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBta_0097 (trpB)
Enzymes [BR:bbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBta_0097 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(103996..105219)
Genome map
AA seq 407 aa AA seqDB search
MTTARPNSYRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYADAKADPAFQAEMNSYRT
HYVGRPSPLYYAERLTQHLGGAKIYFKRDELNHTGSHKVNNVLGQIMLARRMGKRRIIAE
TGAGQHGVATATLCARFGLDCVVYMGAVDVERQQPNVLRMEMLGAKVVPVQSGARTLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQSVIGDETRVQMQEAEGRLPDSLVA
CIGGGSNAMGLFHPFLDDPSVEIFGVEAAGHGLTQLHAASIAGGRPGVLHGNRTYLLMDE
DGQIAEAHSISAGLDYPGIGPEHSWLFEAKRVTYLSATDDEALAAFQLLSRLEGIIPALE
PAHAIAKVMELAPKKPKEHLMVVNLCGRGDKDVPQVGEILRKRAKES
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagcacgtccaaattcctaccgcagcggtcctgacgagcgcgggcatttcggc
atcttcggcggccgcttcgtggccgaaaccctgatgccgctgatcctggatctggaaaag
gcctatgccgacgccaaggccgatccggcgttccaggccgagatgaacagctatcggacg
cattatgtcggccgtccgtcgccgctgtactacgccgaacgtctgacccagcatctcggc
ggcgccaagatctatttcaagcgcgatgagctcaatcataccggctcgcacaaggtcaac
aacgtgcttggccagatcatgctggcgcgccgcatgggcaagcggcgcatcatcgcggag
acgggtgccggccagcatggcgtcgccaccgccacgctgtgcgcccgcttcgggctggat
tgcgtggtctatatgggcgcggtcgacgtcgaacgtcagcagcccaacgtgctccgcatg
gagatgctcggcgccaaggtggtgccggtgcagtcgggtgcccgcacgctgaaggacgcg
atgaacgaggcgctgcgcgattgggtcaccaacgtccacgacacgttctactgcatcggc
acggtcgccggtccgcacccttatccgatgatggtgcgcgacttccagtcggtgatcggc
gacgagacgcgggtgcagatgcaggaggccgaaggccggctgccggactctctggtcgcc
tgcatcggcggcggctccaatgcgatgggcctgtttcatcccttcctcgacgatccctcc
gtcgagatcttcggcgtcgaagccgcaggccatggcctgacgcagctgcatgccgcgtcg
atcgccggcggccgtcccggcgtgctgcacggcaaccgcacctatctgctgatggacgag
gacggccagatcgccgaggcgcattcgatctcggccggcctcgattatcccggcatcggc
cctgagcattcctggctgttcgaagccaagcgcgtgacctatctctcggccaccgatgac
gaggcgctggcggcgttccagctgctgtcgcggctggaaggcatcatcccggcgctcgaa
ccggcgcatgccatcgccaaggtgatggagctcgcgccgaagaagccgaaggaacacctg
atggtcgtcaatctgtgcggccgcggcgacaaggacgtgccgcaggtcggtgagatcctg
cgaaagagggcgaaagagtcgtga

DBGET integrated database retrieval system