KEGG   Bradyrhizobium sp. BTAi1: BBta_0216Help
Entry
BBta_0216         CDS       T00528                                 

Gene name
rpmI
Definition
(GenBank) LSU ribosomal protein L35P
  KO
K02916  
large subunit ribosomal protein L35
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BBta_0216 (rpmI)
Ribosome [BR:bbt03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BBta_0216 (rpmI)
  Bacteria
    BBta_0216 (rpmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(223619..223819)
Genome map
AA seq 66 aa AA seqDB search
MPKLKTKSGAKKRFKVTATGKVMHAQRGKRHGMIKRTKKQIRQLRGTRVLFKTDGDNVKK
YFLPNA
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagctgaagaccaaatccggcgccaaaaagcgcttcaaggtgactgccaccggc
aaagtgatgcacgcccagcgcggcaagcgccacggcatgatcaagcggacgaagaagcag
atccggcagctgcgcggcacccgcgtgctgttcaagaccgacggcgacaacgtcaagaag
tacttcttgccgaacgcctga

DBGET integrated database retrieval system