KEGG   Bradyrhizobium sp. BTAi1: BBta_0229Help
Entry
BBta_0229         CDS       T00528                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00020  Citrate cycle (TCA cycle)
bbt00190  Oxidative phosphorylation
bbt00650  Butanoate metabolism
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01200  Carbon metabolism
Module
bbt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bbt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBta_0229 (sdhD)
   00650 Butanoate metabolism
    BBta_0229 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BBta_0229 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABQ32525
RhizoBase: BBta_0229
UniProt: A5E8N1
Position
234516..234890
Genome map
AA seq 124 aa AA seqDB search
MRTPLGRVRNLGAAHSGTSDFWRQRITAVAMTLLIVPVVVVVIMLLGRNQAGAAQILGSL
PIALIMLLFVIASCWHMKIGMQVVIEDYVHSEPLKLVAIMANNFFAVTVALASIYALIKL
STGV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcggaccccgctgggccgcgtccgcaacctcggcgccgcccattccggcaccagcgac
ttctggcgccagcgcatcaccgcggttgcgatgaccttgctgatcgtgcccgtggtcgtg
gtggtgatcatgctgctcggccgcaaccaggccggcgctgcgcagatcctcggctcgctg
ccgatcgcgctgatcatgctgctgttcgtcatcgcgagctgctggcacatgaagatcggc
atgcaggtcgtgatcgaggactatgtccacagcgagccgcttaagctcgttgcgatcatg
gctaacaacttctttgcggtgaccgtggcgctcgcctcgatctacgccctcatcaaactg
tccactggagtctag

DBGET integrated database retrieval system