KEGG   Bradyrhizobium sp. BTAi1: BBta_0250Help
Entry
BBta_0250         CDS       T00528                                 

Definition
alkaline phosphatase PhoD
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbt00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bbt00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bbt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
258156..259730
Genome map
AA seq 524 aa AA seqDB search
MTIHLSRPQLSRLSRRRFLSTAAAAGVTTLSMPYLSRAADRPQITHGVQSGDVSMDGGVV
WARADRPSQMLVEVATTESFKNARSLPPIAALPESDFTAKMLLENLPSGQDIFYRVKFRD
LSHSAVESEAVVGRFRTAPGNKRDVSFVWGGDVAGQGWGINPDDGGMFTFATMKKHRPDF
FLHSGDTIYADGPIKSEVKLPDNKVWKNLTVEEKAKVAETLDEFRAAHKYNFLDENVRAF
NAEVPIFVQWDDHEVTNNWSASKELPAAYKERNIQLLAARAARAFHEMYPMRESIAEPGR
VYRTINYGPHLDVFVLDERSYRGANGPNLEDKYGPSSYFIGPEQMRWLKQALLNSRATWK
VIASDMPLSLIVYDDAANKKGSEAIAQGDGPARGRELEIAEILRFIKTAPIQNTVWLTAD
VHYAAAHYYDPNKAQFQDFEPFWEFVSGPLHAGTFGPNELDNTFGPEVRFIKAPGLDKQN
LPPSAGMQFFGHVKIEGETGQMTVTLRDRADVALWSTTLDPKLG
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcacctttcgcgcccgcagctgtccaggctgtcccgccgccgattcctctcg
acggcagctgccgccggcgtcacgacgctgtcgatgccctatctgagccgcgccgccgac
cggccgcagatcacgcatggtgtccagtccggcgacgtcagcatggatggcggcgtggtc
tgggcccgtgccgaccgcccgtcgcaaatgctggtcgaggtcgcgacgacagagtcgttc
aagaacgcgcgcagcctgccgccgatcgcggcgctgcccgaaagcgattttaccgccaag
atgctgctggagaacctcccgagcggccaggacatcttctaccgcgtcaaattccgcgac
ctctcgcacagcgccgtcgaaagcgaggcggtggtcgggcgcttccgcaccgcgcccggc
aacaagcgcgacgtctcgttcgtctggggcggcgacgtggcaggacaaggatggggcatc
aatcccgacgatggcggcatgttcaccttcgccaccatgaagaagcaccggcccgacttc
ttcctccattccggcgacacgatctatgccgacggtccgatcaagtccgaggtcaagctg
ccggacaacaaggtctggaaaaacctgacggtggaagagaaggccaaggtcgccgagacg
ctcgacgaattccgggcggctcataagtataacttcctcgacgagaacgtccgcgccttc
aatgccgaggtgccgatcttcgtgcagtgggacgatcacgaggtgaccaacaactggtcg
gcctccaaggagctgccggcggcctacaaggagcgcaacatccagctgctcgccgcgcgc
gcggcccgcgccttccacgagatgtatccgatgcgcgagagcatcgccgagcctggccgg
gtctatcgcaccatcaattacggcccgcatctcgacgtcttcgtgctcgacgagcgcagc
tatcgcggcgccaacggcccgaacctcgaggacaaatatggcccgtcgtcctatttcatc
gggcccgagcagatgcgctggctgaagcaggcgctgctgaactcgcgcgcgacctggaag
gtgatcgcctccgacatgccgctcagcctgatcgtctatgacgacgcggccaacaagaag
ggctctgaggcgattgcgcagggcgacggtccggcgcgcgggcgcgagctggagatcgcc
gagatcctgcgcttcatcaagaccgcgccgatccagaacacggtgtggctgacggcggac
gtgcactacgccgccgcgcattactatgatccgaacaaggcgcagttccaggacttcgag
ccgttctgggagtttgtctcgggcccgctgcatgccggcacgttcggcccgaacgagctc
gacaacactttcggccccgaggtgcgcttcatcaaggcgccgggtctcgacaagcagaac
ctgccgccgtcagccggcatgcagttcttcgggcacgtcaagatcgagggcgagaccggg
cagatgaccgtgaccctgcgcgatcgcgccgacgtcgcgctgtggtcgacgacccttgac
ccgaagctcggctga

DBGET integrated database retrieval system