KEGG   Bradyrhizobium sp. BTAi1: BBta_0276Help
Entry
BBta_0276         CDS       T00528                                 

Definition
cytochrome P450 hydroxylase (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bbt00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bbt00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bbt00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(279461..280843)
Genome map
AA seq 460 aa AA seqDB search
MSTAEIHYLPQARAPLVPPMPPRAPDSMGAFRRVLLMGENAIATWSQRAYEDEIVRGRFF
GSSSYILNTPDTIKHVLVDNWENYVRTDGAIRVLRPVLGEGLLIAEGRAWKHQRRTLAPA
FTPRAVAGLIPHMIAVTDDTVTRLKQQCDAPVDLREIMQRMTLDIAGRTMFSFEMGRHGA
TLRDFVFEYGARLASPHLLDIVLPLSWPTPRDIARRRFRKRWTAFVTLLMAERRAAGKLD
DAPPRDLFDLMGAARDPETGAAFTDAQLADEVATMILAGHETTATALFWALYLIALDPAS
QSKLAQEAGAASDLGDPDRLPFTRAVIDETLRLYPPAFLIARAASGPDRLADFPVKRGDV
VLISPWLLHRHEKLWRAPNAFMPERFLPGAAPPERFAYLPFGAGARVCIGAHFALVEAVL
ALARLVGAFKIELIDRAPVMPIGVVTTQPDRSPLFRITPR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgccgagatccattatttgccgcaggcccgagcaccgctcgttcctccgatg
ccgccgcgtgcgcccgacagcatgggcgcgttccgtcgcgtactgctgatgggagagaac
gcgatcgcaacctggagccagcgcgcctatgaggacgagatcgtccgcggccggttcttc
ggcagctcgagctacattctcaacacacccgacacgatcaagcatgtgctggtcgacaat
tgggagaactatgttcgcaccgacggtgccatccgcgtgctgcgaccggtgctcggcgaa
ggcctgctcatcgccgagggcagggcctggaagcaccagcgccgcactctggcgccggca
ttcacgccgcgcgccgtagcggggctgattccgcacatgatcgcggtgaccgatgacacc
gtgacgcggctgaagcagcaatgcgacgcgccggtcgacctgcgcgagatcatgcagcgc
atgacgctcgacatcgccgggcgcacgatgttctcgttcgagatgggccgtcacggcgcg
accttgcgcgacttcgtgttcgaatatggcgcgcggctggccagcccacatctgctcgac
atcgtgctgccgctgtcctggccgacgccgcgcgacatcgcccgccgtcgcttccgcaag
cgctggaccgccttcgtcaccctgctgatggcggagcgccgggccgccggcaagctggac
gacgcgccgccgcgcgacctgttcgacctgatgggcgcggcacgcgatccggagaccggt
gcggccttcaccgatgcgcaactcgccgacgaggtcgcgaccatgatcctcgccggccac
gagaccaccgcaacggcgctgttctgggcgctgtatctgatcgcgctcgatccagccagc
cagagcaagctggcgcaggaagctggcgcggccagcgatctcggcgatccggatcgattg
ccgttcacccgcgccgtgatcgacgaaacgctcaggctgtatccgccggccttcctgatt
gcgcgggcggccagcgggccggaccggctcgcggactttccggtcaagcgcggcgacgtg
gtgctgatctcgccctggctgctgcatcggcacgaaaagctctggcgcgcgcccaacgcg
ttcatgcccgagcgattcctgccgggcgccgcgccgcctgagcgcttcgcctatctgccg
ttcggcgccggagcgcgggtctgtatcggcgcccattttgcgctggtcgaagccgtgttg
gcgctggcgcgcctggtcggcgcattcaagatcgagctcatcgaccgcgcgccggtgatg
cccatcggggtggtgacgacgcagccggaccggtcgccgctgttcaggatcacgccgcgc
tga

DBGET integrated database retrieval system