KEGG   Bradyrhizobium sp. BTAi1: BBta_0276Help
Entry
BBta_0276         CDS       T00528                                 

Definition
cytochrome P450 hydroxylase (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BBta_0276
  Amino acid metabolism
   00380 Tryptophan metabolism
    BBta_0276
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BBta_0276
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BBta_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(279461..280843)
Genome map
AA seq 460 aa AA seqDB search
MSTAEIHYLPQARAPLVPPMPPRAPDSMGAFRRVLLMGENAIATWSQRAYEDEIVRGRFF
GSSSYILNTPDTIKHVLVDNWENYVRTDGAIRVLRPVLGEGLLIAEGRAWKHQRRTLAPA
FTPRAVAGLIPHMIAVTDDTVTRLKQQCDAPVDLREIMQRMTLDIAGRTMFSFEMGRHGA
TLRDFVFEYGARLASPHLLDIVLPLSWPTPRDIARRRFRKRWTAFVTLLMAERRAAGKLD
DAPPRDLFDLMGAARDPETGAAFTDAQLADEVATMILAGHETTATALFWALYLIALDPAS
QSKLAQEAGAASDLGDPDRLPFTRAVIDETLRLYPPAFLIARAASGPDRLADFPVKRGDV
VLISPWLLHRHEKLWRAPNAFMPERFLPGAAPPERFAYLPFGAGARVCIGAHFALVEAVL
ALARLVGAFKIELIDRAPVMPIGVVTTQPDRSPLFRITPR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgccgagatccattatttgccgcaggcccgagcaccgctcgttcctccgatg
ccgccgcgtgcgcccgacagcatgggcgcgttccgtcgcgtactgctgatgggagagaac
gcgatcgcaacctggagccagcgcgcctatgaggacgagatcgtccgcggccggttcttc
ggcagctcgagctacattctcaacacacccgacacgatcaagcatgtgctggtcgacaat
tgggagaactatgttcgcaccgacggtgccatccgcgtgctgcgaccggtgctcggcgaa
ggcctgctcatcgccgagggcagggcctggaagcaccagcgccgcactctggcgccggca
ttcacgccgcgcgccgtagcggggctgattccgcacatgatcgcggtgaccgatgacacc
gtgacgcggctgaagcagcaatgcgacgcgccggtcgacctgcgcgagatcatgcagcgc
atgacgctcgacatcgccgggcgcacgatgttctcgttcgagatgggccgtcacggcgcg
accttgcgcgacttcgtgttcgaatatggcgcgcggctggccagcccacatctgctcgac
atcgtgctgccgctgtcctggccgacgccgcgcgacatcgcccgccgtcgcttccgcaag
cgctggaccgccttcgtcaccctgctgatggcggagcgccgggccgccggcaagctggac
gacgcgccgccgcgcgacctgttcgacctgatgggcgcggcacgcgatccggagaccggt
gcggccttcaccgatgcgcaactcgccgacgaggtcgcgaccatgatcctcgccggccac
gagaccaccgcaacggcgctgttctgggcgctgtatctgatcgcgctcgatccagccagc
cagagcaagctggcgcaggaagctggcgcggccagcgatctcggcgatccggatcgattg
ccgttcacccgcgccgtgatcgacgaaacgctcaggctgtatccgccggccttcctgatt
gcgcgggcggccagcgggccggaccggctcgcggactttccggtcaagcgcggcgacgtg
gtgctgatctcgccctggctgctgcatcggcacgaaaagctctggcgcgcgcccaacgcg
ttcatgcccgagcgattcctgccgggcgccgcgccgcctgagcgcttcgcctatctgccg
ttcggcgccggagcgcgggtctgtatcggcgcccattttgcgctggtcgaagccgtgttg
gcgctggcgcgcctggtcggcgcattcaagatcgagctcatcgaccgcgcgccggtgatg
cccatcggggtggtgacgacgcagccggaccggtcgccgctgttcaggatcacgccgcgc
tga

DBGET integrated database retrieval system