KEGG   Bradyrhizobium sp. BTAi1: BBta_0288Help
Entry
BBta_0288         CDS       T00528                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBta_0288
Enzymes [BR:bbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BBta_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(293161..293898)
Genome map
AA seq 245 aa AA seqDB search
MAVLVTRPAPDNDRSATALRARGFEVLLAPMLRFEPVALPDDAGRDAAAVIVTSSNALRA
AAPQLARSALLTLPLFAVGEHTAAAARQAGFTQVMSADGDAGALRDLVTRERANGRIKAD
APLLYLAGADISRDLAGELAGRGFEVITQTVYRMAPVTTLPRDVCDAFAKNAITAVLHYS
RRSAAAFVAAIRADGVEISALAVPHCCMSANVAEVLREAGATQVTIAAHPNENDMLEGLT
RALRS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgctggtgacccgtcccgctcccgacaatgaccgcagcgccacagcgcttcgt
gcgcgcggcttcgaggtgctgctggcgccgatgttgcgattcgagcccgtcgcgctgccc
gatgacgccggccgcgatgccgcggctgtcatcgtgacgtcgtcgaacgcgctgcgcgcg
gcagcaccgcagctcgcgcggtccgcgttgctgaccctgccgctgttcgcggtcggcgag
cacaccgcggcggcggcgcgccaggccggcttcacccaggtgatgtccgccgacggcgat
gcaggcgccttgcgcgatctcgtcacgcgcgagcgcgccaacggccgcatcaaggcggat
gcgccgctgctctatctcgccggagccgacatttcgcgcgatctcgcgggcgagctcgcc
gggcgcggcttcgaagtgatcacccagaccgtctaccgcatggccccggtgacgacgctg
ccgcgcgacgtctgcgatgcattcgcaaagaacgccatcacggccgtgctgcattattcg
cggcgaagtgccgcggccttcgtcgcggcgatcagggccgatggcgtcgaaatttcggcg
ctggccgtgccgcattgctgcatgtcggccaatgtcgccgaggtgctgcgcgaagctggc
gcgacgcaggtcacaatcgcggcgcatccgaatgaaaacgacatgctggaggggctgacc
cgtgcgctacggtcgtga

DBGET integrated database retrieval system