KEGG   Bradyrhizobium sp. BTAi1: BBta_0370Help
Entry
BBta_0370         CDS       T00528                                 

Definition
(GenBank) putative exported protein of unknown function
  KO
K09807  
uncharacterized protein
Organism
bbt  Bradyrhizobium sp. BTAi1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(369478..370188)
Genome map
AA seq 236 aa AA seqDB search
MMIRPILAAAIASCVALPAVAQDGPRLDMPAITVSGEASVSAPPDLAQIDAGVASDAKTA
REAAEANNAAMAKVLQALKTAGLADKDVQTSRLSLQPQYAPNRPGQTQVTGYRASNRVTI
KLREVGKVASVIDTVVGAGANDVGNVYFTVAEPSKLLDDAREKAVADARRKAEIYAKAAG
VTLGKPLSISEDGASAPVFRAKNFGAPMAATPTPVAQGEETLSITVNVTWAIKAGP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcagaccgatcctggcagccgcgatcgcgagctgcgtcgcgcttcctgcggtc
gcgcaggacggaccgcggctggacatgccggccatcaccgtcagcggcgaggccagcgtc
tcggcgcccccggacctggcgcagatcgatgccggggtggcgtccgacgccaagaccgcg
cgcgaggccgccgaggccaacaatgccgcgatggccaaggtgctccaggcgctgaagacg
gcgggattggccgacaaggatgtccagacctcgcggctgtcgctgcagccgcaatatgcc
ccgaaccgaccgggccaaacgcaggtcaccggctatcgggcctcgaaccgcgtcaccatc
aagctacgggaagtgggcaaagtggccagcgtgatcgacacggtggtcggcgccggcgcc
aacgatgtcggcaacgtctatttcaccgttgccgagccgtcgaagctgctcgatgacgcg
cgcgagaaggctgttgccgacgcgcggcgaaaggccgagatctacgccaaggcggccggc
gtcacgctcggcaagccgctcagcatctccgaggacggcgcctccgcgccggtgttccgc
gccaagaacttcggcgcaccgatggccgcgacgccgaccccggtggcgcaaggcgaggag
acgctgtcgatcacggtcaatgtcacctgggcgatcaaggccgggccgtag

DBGET integrated database retrieval system