KEGG   Bradyrhizobium sp. BTAi1: BBta_0389Help
Entry
BBta_0389         CDS       T00528                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I (EC:3.1.1.5 3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bbt01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
389212..389844
Genome map
AA seq 210 aa AA seqDB search
MHILVLMLAMMTMGPAFAGAEAGKPIKLVVLGDSLSAGLGLSASDAFPAKLQKALNDKGL
KVEMTNAGVSGDTSSGGRDRLDWSVADGTEAVIVELGANDALRGIDPSVTRQALTEIVQR
LKARGIAVMLCGMLAPPNYGSDYAAKFNAIYPDLAKQFDVQLYPFFLDGVAADPKLNQAD
GIHPTAAGVDIIVSRMLPMVEAFLRPLREQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgcacatactcgtgttgatgctcgccatgatgacaatggggccggcattcgcgggcgcc
gaggccggcaagccgatcaagctggtggtgcttggcgactccttgagcgcgggcctcggc
ctgtcggcttcggatgcgtttccggccaagcttcaaaaggcgttgaacgacaaggggctg
aaggtcgagatgaccaatgccggggtgtccggcgacacctcctcgggcggacgcgaccgg
ctcgattggtcggtggccgatggcaccgaggccgtgatcgtcgagctcggcgccaatgat
gctttgcgcggcatcgatccgtcggtcacgcggcaggcgctgaccgagatcgtccagcgg
ctgaaggcgcggggcatcgcggtgatgctgtgcggcatgctggcgccgccgaattacggc
agcgattacgctgcgaaattcaacgcgatctaccccgacctcgccaagcagttcgacgtc
cagctttacccgttctttctcgacggtgttgccgccgatcccaagttgaaccaggccgac
ggcattcaccccacggccgcgggcgtcgacatcatcgtctcccggatgttgcctatggtg
gaagcattcctgcgtccgcttcgtgagcaatga

DBGET integrated database retrieval system