KEGG   Bradyrhizobium sp. BTAi1: BBta_0422Help
Entry
BBta_0422         CDS       T00528                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00330  Arginine and proline metabolism
bbt00332  Carbapenem biosynthesis
bbt01100  Metabolic pathways
bbt01130  Biosynthesis of antibiotics
bbt01230  Biosynthesis of amino acids
Module
bbt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BBta_0422 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BBta_0422 (proB)
Enzymes [BR:bbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BBta_0422 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABQ32708
RhizoBase: BBta_0422
UniProt: A5E964
Position
complement(425021..426157)
Genome map
AA seq 378 aa AA seqDB search
MASPRLENFRRIVVKVGSSLLVDSEAGEVRASWLAALAADIARLHGRGCELLVVSSGSIA
LGRSRLKLPRGPLKLEESQAAAAVGQIALARIWSEVLGDHGIGAGQILVTLQDTEERRRY
LNARSTIAKLLDWRAVPVINENDTVATAEIRYGDNDRLAARVATMASADLLVLLSDIDGL
YTAPPAQDPNARLIPVVESITADIEAMAGSAASEFSRGGMRTKIEAAKIATTGGTHMLIA
SGKIEHPLAAIANGGRCTWFLTPANPVTARKRWIAGSLEPKGTLTIDAGAVTALRAGKSL
LPAGVIRVDGQFARGDAVVVRGPDTHEIGRGLVAYDADDAERIKGRSSPDVAVILGISGR
AEMIHRDDLVIGPAGAMG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggccagcccccgtctcgaaaatttccgccgtatcgtcgtcaaggtcggctcgtcgctg
ctggtcgattccgaggccggcgaggtccgcgcctcctggcttgcggcgctcgccgccgac
atcgcgcgactgcatggtcgaggctgcgagctcctggtggtgtcgtcaggctcgatcgca
ctcggccgcagccggctgaagctgccgcgcgggccgctcaagctggaggagagccaggca
gccgccgccgtcggccagatcgcgttggcgcggatctggtcggaggtgctgggtgaccac
ggcatcggcgccggacagatcctggtcaccttgcaggacaccgaggagcgccgccgctat
ctcaatgcgcgctcgacgatcgccaagctgctggactggcgcgcggtgccggtcatcaac
gagaacgacaccgtcgcgacggcagaaatccgctacggcgacaatgaccgcctcgccgca
cgcgtcgcgaccatggccagtgccgacctgctggtgctgctgtccgacatcgacggactc
tacaccgcgccgccggcgcaggatccgaacgcgcggctgattccggtggtcgagagcatc
accgccgacatcgaggcgatggccggcagcgccgcgtccgagttctcgcgcggcggcatg
cgcaccaagatcgaggccgccaagatcgccacgaccggcggtacccacatgctgatcgcc
tccggcaagatcgagcacccgctggcggcgatcgccaatggcggccgctgcacctggttc
ctgacccccgccaaccccgtcaccgcgcgcaaacgctggatcgcgggctcgctggagccg
aagggcacgctgaccatcgacgccggcgccgtgaccgcgctgcgcgccggcaagagcctg
ctgcccgccggcgtcatccgggtggacggccagttcgcccgcggcgatgcggtggtggtg
cgcgggccagatacccacgagatcggccgcggcctggtcgcatatgacgccgacgacgcc
gagcgcatcaagggccggtcctcgccagatgtcgccgtcatcctcggcatctccggccgc
gccgagatgatccatcgcgacgacctggtgatcggcccggcgggcgcaatgggatag

DBGET integrated database retrieval system