KEGG   Bradyrhizobium sp. BTAi1: BBta_0743Help
Entry
BBta_0743         CDS       T00528                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BBta_0743
Enzymes [BR:bbt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BBta_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
763099..764304
Genome map
AA seq 401 aa AA seqDB search
MSFPAMRRTRHAGLQGHRRSLRRHHPDFDKMATQGWQALEAEGKLPSNGWRKERQWALDM
GLPGADTLTDRDIPTFARGELPHFAGINTFMKAPYVENVRDVGKYDAAVIGIPFDSGTTY
RPGTRFGPQGIRRISALYTPYNYELGVDLREQMTLCDAGDVFTIPANLEKSFDQISRGVA
HVFSSGALPIMLGGDHSIGFPCVRGIAQCTDKKIGIIHFDRHIDIQEKDLDERMHTTPWY
WATNLPNVSPTNLVQLGIGGWQVPREGVEVARKRNTNVLTIADIEKIGLEKTAEIALELA
WKDADAVYISFDVDSIDCGFVPGTGWPEPGGFLPREALKLLGLVAAEGLCGLEVVEVSPP
YDTSDITALIGVRVVVEALGSMVAHGKLGSHKHIINKPVSY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcccagccatgcgccgcacgcgccatgccggattacaaggtcatcgccggagc
ctgcgccgtcaccatccggacttcgacaagatggccacgcaaggctggcaggcgctggag
gccgaaggcaagctgccaagcaatggctggcgcaaggagcggcaatgggcgctcgacatg
ggcctgcccggcgccgacacgctgaccgatcgcgacatccccacattcgcacgcggcgag
ctgccgcatttcgcgggcatcaacaccttcatgaaggcgccctatgtcgagaacgtccgc
gacgtcgggaaatatgacgccgcggtcatcggcatccccttcgattccggcaccacctat
cgcccaggcacccgcttcggaccgcagggcatccgccgcatctccgcgctctacacgccc
tacaattacgagctcggcgtcgacctgcgcgagcagatgaccctgtgcgacgccggcgac
gtcttcaccattcccgccaatctggaaaagagcttcgaccagatcagccgcggcgtcgcg
catgtgttctcgtccggcgcgctgccgatcatgctcggcggcgaccactcgatcggcttc
ccctgcgtgcgcggcatcgcgcaatgcaccgacaagaagatcggcatcatccatttcgac
cgccatatcgatatccaggagaaggatctcgacgagcgcatgcacacgacgccctggtac
tgggcgaccaatttgccgaacgtgtcgccgaccaatctggtgcagctcggcatcggcggc
tggcaggtgccgcgcgagggcgtcgaggtcgcgcgcaagcgcaacaccaatgtgctgacc
atcgccgacatcgagaagatcggtctggagaagaccgccgagatcgcactcgaactggcc
tggaaggacgccgacgccgtctacatctcgttcgacgtcgactccatcgattgcggtttc
gtgcctggcaccggctggccggagcccggcggcttcctgccgcgcgaggcgctgaagctg
ctcggcctcgtcgcggccgagggcctgtgcggcctcgaagtggtcgaggtctcgccgccc
tacgacacctccgacatcaccgcgctgatcggcgtccgcgtcgtcgtggaagcgctcggc
tcgatggtcgcgcatggcaagctcggcagccacaagcacatcatcaacaagccggtcagc
tattga

DBGET integrated database retrieval system