KEGG   Bradyrhizobium sp. BTAi1: BBta_0751Help
Entry
BBta_0751         CDS       T00528                                 

Definition
(GenBank) Putative short-chain dehydrogenase/reductase (SDR) (EC:1.1.1.-)
Organism
bbt  Bradyrhizobium sp. BTAi1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(772488..773297)
Genome map
AA seq 269 aa AA seqDB search
MLKNLFSLDGRIALVTGGSRGIGKMIAAGLLAQGAARVYITARKAGPCEETAKQLTAEYG
GECIALPIDISTMAGIDRLAAEIKQREPKLDILVNNAGAAWGADFDEFPESGWDKVMNLN
VKTPFFLTKALAAPLRAAASAERPAKVINIASIDGIFVNPLETYSYAASKSGLIHLTRRM
AAKLIHDHIVVTAIAPGPFKSDMNKAARDHEDEVAKRVPAGRIGTDEDMAGTAIFLASRA
GDYVVGNTIAVDGGIVYANPGIPGAGWDS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagaacctgttctcactcgatgggcgcatcgcgctcgtcaccggcggctcgcgc
ggcatcggcaagatgatcgcagccggcctgctcgcgcagggcgctgcgcgggtctacatc
accgcgcgcaaggccggcccgtgcgaggagacggccaagcagctgacggccgaatatggc
ggcgaatgcatcgcgcttccgatcgacatctcgacgatggccggcatcgataggctggcg
gcggagatcaagcagcgcgagccgaagctcgacatcctggtcaacaatgcgggcgcggcc
tggggcgcggatttcgacgaattcccggagagcggctgggacaaggtgatgaacctcaac
gtcaagacgccgttcttcctgaccaaggcgctggcagcgcccttgcgtgcagccgcgagc
gcggagcgtccggcgaaggtcatcaacatcgcctcgatcgacggcatcttcgtcaatccg
ctggagacctattcctacgcggccagcaagtcggggctgatccatctgacgcggcgcatg
gcggcgaagctgatccacgaccacatcgtggtgaccgcgatcgcgccaggaccgttcaag
tcggacatgaacaaggccgcgcgcgaccatgaggacgaggtcgccaagcgcgttccggcg
gggcgcatcggcaccgacgaggacatggccggcaccgcgatcttcctcgcttcgcgcgcg
ggcgactacgtggtggggaatacgatcgcagtcgacggcggcatcgtctacgcgaacccg
ggcattccgggtgcgggctgggatagttga

DBGET integrated database retrieval system