KEGG   Bradyrhizobium sp. BTAi1: BBta_0817Help
Entry
BBta_0817         CDS       T00528                                 

Definition
short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35 4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBta_0817
   01212 Fatty acid metabolism
    BBta_0817
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BBta_0817
   00650 Butanoate metabolism
    BBta_0817
  Lipid metabolism
   00071 Fatty acid degradation
    BBta_0817
   01040 Biosynthesis of unsaturated fatty acids
    BBta_0817
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBta_0817
   00310 Lysine degradation
    BBta_0817
   00380 Tryptophan metabolism
    BBta_0817
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBta_0817
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBta_0817
   00281 Geraniol degradation
    BBta_0817
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BBta_0817
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BBta_0817
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BBta_0817
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BBta_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
844278..846491
Genome map
AA seq 737 aa AA seqDB search
MAFKNFKLETDADGIALITWDIPGRSMNVLDETSTNELEALVKETTADAAIKGVVITSAK
EAFCAGADLSMLEGMNRLYADVLKSKGEEAANQMLFDTSRRFSQINRAMETSGKPWVAAI
NGLALGGGFEITLSCHYRVAAENPKTRLGLPEIKVGLFPGAGGTQRVPRIVQPQDAMNLL
LKGEALTLDKAKALKLVDAIVPAADLIKAAKDWIKGGGKAVQPWDEKGFKLPGGPVFSKN
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLQLPIDAALRVESRYFTKILRSKEAAA
MIRSLFLSMQELNKGARRPADVPATKLKKIAVIGAGFMGASVGYVSARGGLDVVLIDRDQ
ESADKGKAHAQSVIDGLVKKGRAKPSEAEAIMGRITATADYAALKDCDLVIEAVFEDRKV
KAETYAKAQAYLKDGAIFASNTSTLPITSLAEEFKDQGRFIGIHFFSPVEKMMLVEIIMG
KATGDVALATALDYVRSIGKTPIVVNDSRGFFANRCVMRYIAEGNEMFLEGVPPALIENA
AKMAGMPVGPLSLSDEVALDLGLKIMKATEHDLGPNAINQDHKKLMVELVEKQGRFGRKN
GKGFYDYPEKGKGQKSLWPDLAKLQPKHLDPDTLDVEELKQRFLVVQAVEAARTVEDHVI
TDVREADVGSILGFGFAPFTGGTLSYIDFMGTKKFVELCHTFTAKYGSRFAPPKLLEEMA
AKGETFYGRFPPKKAAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaagaacttcaaactggaaaccgatgccgacggcattgcgctgatcacctgg
gacattccgggccgttcgatgaacgtgctcgacgagacctcgacgaatgagctcgaggct
ctcgtgaaggaaaccaccgccgatgccgccatcaagggcgtcgtcatcacctcggccaag
gaggcgttctgcgccggcgccgatctgtcgatgctcgagggcatgaaccgcctctatgcc
gacgtgctgaagagcaagggcgaggaagccgccaaccagatgctgttcgacaccagccgg
cgcttctcgcagatcaaccgggcgatggaaacgtccggcaagccgtgggtcgccgcgatc
aacggcctcgcgctcggcggcggcttcgagatcaccctgtcgtgccactaccgcgttgcg
gccgagaatccgaagacgcggctcggcctgcccgagatcaaggtcggcctgttccccggc
gccggtggcacccagcgcgtgccgcgcatcgtgcagccgcaggacgccatgaacctgctg
ttgaagggcgaggcgctcacgctcgacaaggccaaggcgctgaagctggtcgacgcgatc
gtgccggcggcggatctcatcaaggcggccaaggactggatcaagggcggcggcaaggcg
gttcagccgtgggacgagaagggcttcaagctgcccggcggcccagtgttctccaagaac
ggcatgatgatgttcccggccggcaacgccatctaccgccgcgagacctacgacaattat
ccggcggcgcgcgccatcatgagctgcgtctatgaaggcctgcagttgccgatcgacgcc
gcgctgcgcgtcgaatcgcgctacttcaccaagatcctgcgctcgaaggaagccgcggcc
atgatccgcagcctgttcctgtcgatgcaggaattgaacaagggcgcgcgtcgccccgcg
gacgtgccggcgaccaagctcaagaagatcgccgtgatcggcgccggcttcatgggcgcc
tccgtcggctacgtctcggcccgcggcggcctcgatgtcgtgctgatcgatcgcgaccag
gagagcgccgacaagggcaaagcgcatgcgcagagcgtgatcgacggcctggtcaagaag
ggccgcgccaagccaagcgaggccgaggcgatcatgggccgcatcaccgcgaccgccgac
tacgccgcgttgaaggattgcgacctcgtgatcgaggccgtgttcgaggaccgcaaggtc
aaggccgagacctacgccaaggcacaggcctatctgaaggacggcgcgatcttcgcttcc
aacacctcgaccttgccgatcacctcgctggccgaggagttcaaggaccagggtcgcttc
atcggcatccacttcttctcgccggtcgagaagatgatgctggtcgagatcatcatgggc
aaggcgaccggcgacgtcgcgctggcgaccgcgctggactatgtccgctccatcggtaag
accccgatcgtggtcaacgactcccgcggcttcttcgccaatcgctgcgtgatgcgctac
atcgccgagggcaacgagatgttcctcgaaggcgtgccgccggcgctgatcgagaacgcc
gccaagatggccggtatgccggtcggaccgctgtcgctgtcggacgaggtcgcgctcgac
ctcggtctgaagatcatgaaggcgaccgagcacgatctcgggcccaacgcgatcaaccag
gaccacaagaagctgatggtcgagctggtcgagaagcagggccgcttcggccgcaagaac
ggcaagggcttctacgattatcccgagaagggcaagggtcagaagagcctgtggccggat
ctggccaagctgcagccgaagcatctcgatccggatacgctggatgtcgaggagctgaag
cagcgcttcctggtggtgcaggcggtggaagccgcgcgcaccgtcgaggaccatgtcatc
accgacgtgcgcgaggccgatgtcggctcgatcctcggcttcggcttcgcgccgttcacc
ggcggcacgctgtcctatatcgacttcatggggacaaagaagttcgtcgagctgtgccac
accttcacggcgaaatacggctcgcgcttcgccccgccgaagctgctggaggaaatggcc
gccaagggcgaaaccttctacggccgcttcccgccgaagaaggcggcggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system