KEGG   Bradyrhizobium sp. BTAi1: BBta_0918Help
Entry
BBta_0918         CDS       T00528                                 

Definition
ABC transporter ATP-binding protein
Orthology
K10111  
multiple sugar transport system ATP-binding protein [EC:3.6.3.-]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
ABC transporters
Module
Putative sorbitol/mannitol transport system
Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BBta_0918
Enzymes [BR:bbt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     BBta_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
950932..951939
Genome map
AA seq 335 aa AA seqDB search
MGRITLEGVQKSFGPVHIIKGADLDIPDGAFVVFVGPSGCGKTTLLRLIAGLEDVSGGRI
LIDGHNVVDVPPAKRGLSMVFQSYALYPHMSVRGNIAFGLKMAGLPKAEINQKVEAAAAT
LNLTPYLDRKPRELSGGQRQRVAIGRAIVREPKAFLFDEPLSNLDAALRVQMRLEVTRLQ
KQLGTTAIYVTHDQVEAMTMADKIVVLNAGRIEQYGSPIELYQKPANLFVAGFIGSPKMN
FITGPEAAQRGATTIGVRPEHIAVVDDGGEGWSGKVLIAEHLGSDTFLYVDAGALGTLTV
RCVGEKRLGAGDAVTLRPEPGRIYRFDNNGLAIFA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggacggatcacgctggaaggtgtgcagaaatcgttcgggccggtccacatcatcaag
ggcgccgacctcgacattcccgacggcgccttcgtggtgtttgtcggcccctccggttgc
ggcaaaaccacgctgttgcggctgatcgccgggctcgaggacgtctcgggcggccgcatc
ctgatcgacggccataatgtcgtcgacgtgccgccggccaagcgcggcctgtcgatggtg
ttccagtcctatgcgctgtatccgcatatgagcgtccgcggcaacatcgccttcggtctg
aaaatggccgggctgccgaaggccgagatcaaccagaaggtcgaggcggccgccgcgacc
ctgaacctcacgccctatctcgaccgcaagccgcgcgaactctccggcggccagcgccag
cgtgtcgcgatcggccgcgccattgtgcgcgaaccgaaggcgttcctgttcgacgagccg
ttgtccaatctcgacgccgcgctgcgcgtgcagatgcggctcgaagtgacgcggctgcag
aagcaactcggcaccacggcgatctatgtgactcacgaccaggtcgaggccatgaccatg
gccgacaagatcgtggtgctgaacgccggccggattgagcaatatggttcgccgatcgag
ctctatcagaagcccgccaatttgtttgtggccggcttcatcggctcgccgaagatgaac
ttcatcaccggccccgaggctgcgcagcgcggcgccacgacgatcggggtgcggcccgag
cacatcgccgtcgtcgatgacggcggcgagggctggtccggcaaggtgctgattgccgag
catctcggcagcgacacctttctctatgtcgatgccggtgcgctgggcacgctgaccgtg
cgctgcgtcggcgagaagcggctcggcgcaggcgacgccgtgacgctgcggcccgagccg
ggccggatctaccgcttcgacaacaatggacttgcgatcttcgcatga

DBGET integrated database retrieval system