KEGG   Bradyrhizobium sp. BTAi1: BBta_1070Help
Entry
BBta_1070         CDS       T00528                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bbt00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bbt00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1112368..1112943
Genome map
AA seq 191 aa AA seqDB search
MHIERYPILGILSLTPVKHGDARGFFSEVYRREIASAAGLPVDFVQENHVFSAQRGVLRG
LHFQRPPRAQGKLVRCIRGAILDVAVDIRTGSPTFGRHVAVELSSANWTQLWVPEGFAHG
YAVLEAPCEVLYKVTDYWAPSSELGLAWDDPDLGIDWRLGRDEVILSDKDRVHPRLSGLA
PVFQFSEKTSS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgagcgctatccgatattgggcattctgtctctcacccctgtgaagcacggc
gatgcgcgtggcttcttttccgaggtgtatcgacgggagatcgcttccgcagcaggtctg
ccggtcgatttcgttcaggagaaccacgtcttctcggcccaacgcggcgtgctgcgtggg
ctgcatttccagcgtccgccgcgcgcgcagggcaagctcgtacgttgtatccgcggtgcc
atcttggacgtggcggtcgatatcagaacgggatctccgaccttcgggcgtcatgttgcc
gtcgaactgtcctccgccaattggacgcaattatgggtccccgaaggctttgcgcacggc
tatgcggtgctggaggcgccttgcgaggttctctacaaagtcaccgactattgggctccg
tcctccgagcttggtcttgcgtgggacgatcctgatctcggcatcgattggcgcctgggc
cgcgacgaggtgatcctgtccgacaaggatcgcgtgcatcctcggctttccggccttgcc
ccggtttttcagttttctgagaagacatcctcatga

DBGET integrated database retrieval system