KEGG   Bradyrhizobium sp. BTAi1: BBta_1374Help
Entry
BBta_1374         CDS       T00528                                 

Definition
lysophospholipase L2, (lecithinase B) (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBta_1374
Enzymes [BR:bbt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BBta_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1464776..1465723
Genome map
AA seq 315 aa AA seqDB search
MTLVSIPANPVPENATAGTIKTPDGAELRFARWAPPSGRKGTVCVFTGRSEMIEKYFETV
RDLRDRGFAVAIIDWRGQGHSSRRLRDSRKGYVRSFSDYELDVETFVTQVVLPDCPPPYF
ALAHSMGGTVLLRLAHAGKRWFDRVVLSAPMIDLPGNRTALPARLLLRVMRIAGQGGRTV
PGGSDEISGLAPFVNNPLTSDPVRYARNAAIIEEDPTLGIASPTVAWADAAFSAMMTFRG
MTYPSQIRQPILMLAASSDTVVSTAAIEEFAYHLRAGSHLVIAGAKHEILQEQDRYRAQF
WAAFDAFVPGTPMFG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgtctcgattcccgccaatcctgtccccgaaaacgccaccgccggcaccatc
aagactcccgatggcgccgagctgcgctttgcgcgctgggcgccgccgtccggacgcaag
ggcacggtctgcgtgttcaccggccgcagcgagatgatcgagaagtatttcgagaccgtg
cgcgatctgcgcgaccgcggctttgcggtcgccatcatcgactggcgcggccagggccat
tcgtcgcggcggctgcgcgattcccgcaagggctatgtgcgctccttctccgactacgag
ctcgacgttgagaccttcgtcacccaggtcgtgctgccggattgtccgccgccctacttc
gcgctggcgcattcgatgggcggcaccgtgttgctcaggctcgcgcatgccggcaagcgc
tggttcgaccgcgtggtgctgtcggcgccgatgatcgacctgccgggcaaccgcaccgcg
ctgccggcgcggctgctgctgcgcgtgatgcgcatcgccgggcagggcggccgcaccgtg
ccgggcggctcggacgagatcagcgggctcgcgcccttcgtcaacaatccgctgacgtcg
gatccggtccgctatgcgcgcaacgccgcgatcatcgaggaggatccgacgctcgggatc
gcctcgccgacggtggcctgggccgacgccgccttttcggcgatgatgacctttcgcggc
atgacctatccttcgcagatccgccagccgatcctgatgctggcggcctccagcgatacc
gtggtgtcgaccgcggcaatcgaggagttcgcctatcatctgcgggccggctcgcatctc
gtcatcgccggggccaagcatgagatcctgcaggagcaggaccgctatcgcgcccagttc
tgggccgccttcgacgccttcgttccgggcacgccaatgtttgggtga

DBGET integrated database retrieval system