KEGG   Bradyrhizobium sp. BTAi1: BBta_1661Help
Entry
BBta_1661         CDS       T00528                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bbt00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bbt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(1732902..1733249)
Genome map
AA seq 115 aa AA seqDB search
MASAALAQDAAAGKTAFNKCLPCHAIGEGAKNKVGPELNGLDGRKSGTVPDYNYSDANKN
SGITWNEAVFKEYIKDPKAKIPGTKMTFAGIKSENEINNLWAYVSSFDKDGKQKQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtggcctctgccgcgctggcgcaggatgccgccgcaggcaagaccgcctttaacaagtgc
ctgccctgccatgcgatcggcgaaggtgcgaagaacaaggtgggcccggaactcaacggc
ctcgacggccgcaaatcgggcactgtgccggactacaactattcagatgcgaacaagaac
tcgggcatcacctggaacgaagccgtgttcaaggaatacatcaaggacccgaaggccaag
atcccgggcaccaagatgaccttcgccggcatcaagagcgagaacgagatcaacaacctg
tgggcgtatgtgtcgtccttcgacaaggacggcaagcagaagcagtaa

DBGET integrated database retrieval system