KEGG   Bradyrhizobium sp. BTAi1: BBta_1708Help
Entry
BBta_1708         CDS       T00528                                 

Definition
(GenBank) putative cytochrome c
  KO
K08738  cytochrome c
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BBta_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABQ33917
RhizoBase: BBta_1708
UniProt: A5ECM3
Position
complement(1780663..1781070)
Genome map
AA seq 135 aa AA seqDB search
MSGRRAAQYALLLCGSFIGAVLSTTIAFAQMALPAPKPVDGATLFKQQCGVCHTLSSAEP
MRQGPPLTKVVGRRAGSVEGFRYSAGFAKADFTWDEARLDAWLTNPQELIPGAVMAYRQA
KPELRAAIITYLKDN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggacggcgtgcggcgcaatacgcgcttcttctgtgtgggtcattcattggcgcg
gtgctgagcaccacgattgcgtttgcgcagatggccctgcctgccccaaagcctgtcgat
ggcgcgaccttgttcaagcagcaatgcggtgtctgccatacgctgagcagcgccgagccg
atgcggcagggaccgccgctgacgaaagtcgtcggccgacgcgcaggttcggtcgaaggc
ttccgctattcggccggcttcgccaaggccgatttcacctgggatgaggccaggctcgat
gcttggctgaccaacccgcaagagctgatccccggcgccgtgatggcctaccgccaagcc
aagcccgaattgcgcgccgcgatcatcacctatctgaaggacaattga

DBGET integrated database retrieval system