KEGG   Bradyrhizobium sp. BTAi1: BBta_2164Help
Entry
BBta_2164         CDS       T00528                                 

Definition
amine oxidase (EC:1.4.3.4)
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBta_2164
   00330 Arginine and proline metabolism
    BBta_2164
   00340 Histidine metabolism
    BBta_2164
   00350 Tyrosine metabolism
    BBta_2164
   00360 Phenylalanine metabolism
    BBta_2164
   00380 Tryptophan metabolism
    BBta_2164
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     BBta_2164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2240161..2241774
Genome map
AA seq 537 aa AA seqDB search
MLETAIVGGGLCGIALARSLQQRGGSFALFEARHRLGGRVLSARSRTGLALDLGPTWFWP
DTQPLLTGLIAELGLSDFAQHDDGTVLHLKEADKSPEPISGPPLHQGARRLSGGMTRLIE
ALVRDLPPSSIHTGHELMRVIDCGTHVRLVFATSTESVAIEAKRAVLALPPRLLIDHVGF
RPELDDATFEAMRSTETWMAAQAKVVIAYDQARWRDKGLSGNAFASHEQAVVGEIFDACD
EGGDRAALGGFLAFAPALRETFAVGLPMLMDSQMVQLFGAELDGGEQHYQDWATERFTCS
ALDRTTPRGEHSEIASPMLRRPLWDGRLHLGGAETASHAAGYLEGAINAARRIERAIARA
ADAPVGARAGVALDEGLTGNEASLAWFAAWVAAQRDAAFDDYRQRLNRSLATQQREQLTQ
LAVLGAIEQVFAAALQVLDALTFDMRNVAVERGRSALMPEIQKPFRDVMQSLLDDAIAFN
RTSCALSNFPFEHRPPKDYVQTILRDIAAAWQEFSLAANHLLLAKADAVRQPSGVSS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaacggccattgtcgggggtggattgtgcggaatcgcacttgcacgcagcttg
cagcaacgcggcggcagcttcgccttgttcgaagcccgacatcgcctgggaggacgtgtc
ctgtctgcgcgcagcaggacgggtctggcgctggatctcggtccgacctggttctggccc
gacacccagccgctgctgaccgggctgattgcggagcttggcctgtctgatttcgcccag
cacgatgacggcacggttctgcacctgaaggaggcggacaagagcccggagccaatcagc
gggccgccacttcaccagggcgcgcgccggctctcgggcggcatgaccaggctgatcgag
gcgctcgtccgtgatctcccgccgtccagcatccataccggccatgagctgatgcgcgtc
atcgattgcggcacccatgtgcgactggtcttcgcgacatcgaccgaatcggtcgccatc
gaggccaagcgtgcggtgctggcgctgccgccgcggctgctgatcgatcacgtcggtttt
cgccccgagctcgacgatgcgaccttcgaggcgatgcgcagtacggagacctggatggcg
gcacaggccaaggtcgtgatcgcctatgaccaggcgcgttggcgtgacaagggcctgtcc
ggcaatgccttcgcgagccacgagcaggctgtcgtcggcgagattttcgatgcttgcgac
gaaggaggtgaccgagctgcgctcggcggctttctcgcctttgcgccagctctgcgcgag
actttcgccgtcggtcttccgatgttgatggacagccagatggtgcagctgttcggcgcg
gagctggatggcggcgagcagcattatcaggattgggcgaccgagcgcttcacctgcagc
gcactggaccgcaccacgccgcgcggcgaacacagcgagatcgccagcccgatgctgcgg
cggccgctatgggacgggcggctacatctcggcggcgccgagactgcaagccatgcggcc
ggctatctcgaaggcgcaatcaatgcggcccggcgcatcgagcgcgcgatcgcccgcgca
gccgacgcgccggtcggcgcgcgcgccggcgtggccctcgacgagggactgaccggcaat
gaggccagcctcgcctggtttgccgcctgggtcgccgcgcagcgcgatgcggccttcgac
gactaccgccagcggctcaaccgcagcctcgcgacgcagcagcgggagcaactgacacag
ctcgcggttctcggcgccatcgagcaggtgttcgcagccgcgctgcaggtgctcgatgcc
ctgaccttcgacatgcgcaacgtggcggtcgagcgtgggcgctcggctttgatgccggag
atccagaagccgttccgcgatgtcatgcagtcgctgctcgacgatgccatcgccttcaac
cgcacctcctgtgcgctgtcgaactttccgttcgagcacaggccgccgaaggattatgtg
cagaccatcctgcgcgacatcgccgccgcctggcaggagttctcgctcgccgccaatcac
ctgttgctggccaaggctgacgcggtgcgccagccgagcggggtgtcgtcgtga

DBGET integrated database retrieval system