KEGG   Bradyrhizobium sp. BTAi1: BBta_2327Help
Entry
BBta_2327         CDS       T00528                                 

Definition
(GenBank) Cytochrome c
  KO
K08738  cytochrome c
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BBta_2327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABQ34499
RhizoBase: BBta_2327
UniProt: A5EEA5
Position
2410065..2410424
Genome map
AA seq 119 aa AA seqDB search
MGAVAAMLVILDAAPARSASDLGEAQFRKNCAMCHSLEPGRNKLGPSLFGVLDRRAGTVA
GFNYSSANKNSGLVWTRETLDAYLADPQTMVPGTLMVFPGIKNGGDRQALVEFLASQHD
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagtcgccgccatgcttgtcatccttgatgcggcaccggcccgttcagcctcc
gacctcggcgaagcccagttcaggaaaaactgtgcgatgtgccattcgctcgagcccggc
cgcaacaagctcgggccgtcgctgttcggcgtgctcgaccgcagggccggtaccgtggcc
gggttcaactactcctcggccaacaagaactccggcctggtgtggacgcgcgagacgctt
gacgcctatctcgccgatccacagacgatggtgccgggcacgctgatggtgtttcccggc
atcaagaatggcggcgaccggcaggcgctggtcgagtttctcgcgagccagcatgactga

DBGET integrated database retrieval system