KEGG   Bradyrhizobium sp. BTAi1: BBta_2348Help
Entry
BBta_2348         CDS       T00528                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBta_2348 (ispE)
Enzymes [BR:bbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BBta_2348 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2436649..2437554
Genome map
AA seq 301 aa AA seqDB search
MLASTVTGAPLQEQGRAKVNLTLRVVGRRVDGYHDLESVVAFADCADQLTLVPGPELTLT
TTGPLAAACGETSDNLVLKAARLLAESVPGLKLGAFELEKVLPVAAGIGGGSADAAAALR
LLARLNGLSLDDPRLQAVALKTGADVPVCVPSRACTMTGVGENLQPLALPVLPCVMINPR
VPVATKDVFQALGLKPGDLLVGVTDVLTAPSWPTAGASIGDWVSALDQVKNDLEPPALKV
QPIIGTVLDALRASHGVLLARMSGSGATCFAIYGSEADAKAAGAQISADHPEWWVHAGTL
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgtccacggtcaccggcgcgccgctgcaggagcagggccgtgccaaggtcaat
ctgacattgcgggtcgtcggccgtcgcgtcgacggctatcacgatctcgaaagcgtcgtc
gccttcgccgattgcgcggatcagctcaccctggtccctgggccggagctgacgctgacc
accaccgggcctcttgccgcggcctgcggtgagacctccgacaatctggtgctgaaggcg
gcgcgcctgctggccgagtccgttcccggcctgaagctcggcgcattcgaattggagaag
gtgctgcccgtcgcggccggcatcggcggcggctcggcggatgcggccgccgcgctgcgg
ctgctcgccagactgaatggcctctcgcttgatgatccgcgtctgcaggcggtggcgctg
aagaccggggccgacgtgccggtctgcgtgccctcgcgggcctgcaccatgaccggcgtc
ggcgagaatctgcagccgctcgcgctgcctgtcctgccctgcgtgatgatcaatccgcgc
gtgccggtggcgaccaaggacgtgttccaggcgctcggtctcaagccgggtgatctcctg
gttggcgtgaccgacgttctcaccgcgccgtcctggccaacggctggggcgtccatcggc
gattgggtctccgcgctcgaccaggtcaagaacgatctcgagcccccggcgctcaaagtg
caaccgatcatcggcaccgtgctcgacgcgctgcgcgcaagccacggcgtgctgctggcc
cggatgtccggctccggtgcgacctgctttgcgatctatggcagcgaggccgatgcaaag
gccgcgggcgcacaaatcagcgctgatcacccggagtggtgggtgcacgcgggcactctg
agttag

DBGET integrated database retrieval system