KEGG   Bradyrhizobium sp. BTAi1: BBta_2511Help
Entry
BBta_2511         CDS       T00528                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BBta_2511
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BBta_2511
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BBta_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2595980..2596531
Genome map
AA seq 183 aa AA seqDB search
MTQLIVYEAGNPSHVLLQTSDFDVIAGKVAALGARIERWEARHPIAPGASNEEVLSAYGH
EIDRLKRERGYTNGDVVRIKPGNPNWPELRGKFLQEHVHVEDEVRFFVEGTGAFYLHLDD
KVYQLVGEAGDLLSVPHGVKHWFDGGPEADFTCIRLFTNQEGWVAHFTGDAISDAFPKYE
IAA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgacccaactgatcgtctacgaagccggcaatccgtcacacgtcctgttgcagacgtcg
gatttcgacgtcatcgccggcaaggtcgcggcgctcggcgcccggatcgagcgctgggag
gcgaggcatccgattgcgccgggagcgagcaacgaagaggtgctgtccgcctatggacac
gagatcgaccgcctgaagcgggagcgcggctacaccaatggcgatgtggtccggatcaag
cccggcaatccgaactggccggagttgcgcggtaagtttctgcaggaacacgtccatgtc
gaggacgaagtgcgcttcttcgtcgagggcaccggcgcgttctatctgcatctcgacgac
aaggtctatcagctggtcggcgaagctggcgacctgctctcggtgccgcacggcgtcaag
cattggttcgatggcgggccggaggctgatttcacctgcatcaggctgttcaccaaccag
gagggctgggtggcgcatttcaccggcgatgcgatctccgacgcattcccgaaatatgag
atcgccgcctga

DBGET integrated database retrieval system