KEGG   Bradyrhizobium sp. BTAi1: BBta_2960Help
Entry
BBta_2960         CDS       T00528                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBta_2960
Enzymes [BR:bbt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BBta_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3081841..3082461)
Genome map
AA seq 206 aa AA seqDB search
MRNTAKKLPFACDPVRVTQDDVEDAIRTILTWIGEDPSREGLSETPARVARAYKSYFAGY
DQNPEEYLRKTFEETAGYDEMVLLRNIPFQSHCEHHMAPIIGRAWVGYVPRSRVVGISKL
ARVVEAYASRLQIQERMTAEIANIIDEVLQPQGVAVVIKAAHHCISSRGVKKHGVDLTTS
RMLGCFRNDPMSRQEFLAMVNADLKD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaacacagccaagaagcttcccttcgcctgcgacccggtccgcgttacccaggac
gatgtcgaagacgccattcgcaccatcctgacatggatcggtgaagacccttcgcgcgag
ggtctctccgagacgccggcgcgtgtcgcccgcgcctataagagctacttcgccggttat
gaccagaaccctgaagagtatctgcgcaagaccttcgaagaaacggccggctatgacgag
atggtgctgctgcggaacatcccgttccagagccattgcgagcatcacatggcgccgatc
atcggccgcgcctgggtcggctacgttccccgcagccgggtcgtcggcatctccaagctc
gcccgcgtcgtcgaggcctatgccagccggctgcagatccaggagcgtatgaccgccgag
atcgccaacatcatcgatgaggtcctgcagccgcagggcgtggccgtcgtgatcaaggca
gcccatcactgcatcagctcgcgcggcgtgaagaagcacggggtcgacctcaccaccagc
cgcatgctgggctgttttcgcaacgatccgatgagccggcaggagttcctggccatggtc
aatgcggacctgaaggattga

DBGET integrated database retrieval system