KEGG   Bradyrhizobium sp. BTAi1: BBta_3024Help
Entry
BBta_3024         CDS       T00528                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3160748..3161239)
Genome map
AA seq 163 aa AA seqDB search
MASALIALGGNVGDVRTTFRQAIPEICRRASARLVARSSGYITPPWGEEQQPPFVNACIA
IETTTAPQALLAKLHEVERMFGRNRAQETRWGPRTLDLDLIAYDDLTIDTPDLTLPHPRL
FERGFVLVPLAEIAPDRRIAGRRVDEALRGVSRDGIRALPSAE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgcgctgattgctctcggtggcaatgtcggcgatgtccgcacgaccttccgc
caggccattccggagatctgccggcgcgcctccgcgcgccttgtggcgcggtcatccggc
tacatcaccccgccatggggcgaggagcagcagccgcccttcgtcaacgcctgcatcgcc
atcgagaccaccactgcaccgcaggctttgctcgcgaaactgcacgaggtcgagcgcatg
ttcggccgtaaccgggcccaggagacccgctggggtccacgcacgctcgatctcgatctc
atcgcctatgacgacctgaccatcgacacgcccgacctcaccctgccccatccgcgcctg
ttcgagcgcggcttcgtgctggtgccgctggcggagatcgccccggatcgccggatcgcc
ggccgccgggtcgacgaggcgctgcggggcgtttcgcgcgacggaatccgggcgttgccg
tcagccgaatag

DBGET integrated database retrieval system