KEGG   Bradyrhizobium sp. BTAi1: BBta_3062Help
Entry
BBta_3062         CDS       T00528                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BBta_3062
Enzymes [BR:bbt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BBta_3062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3200745..3202202)
Genome map
AA seq 485 aa AA seqDB search
MISRRSRALRPEVFSGFSRVELRCNSRTLLATLLITDDDALVGPDEIGLSQPALRRFAEP
AGTFATVSPATPPDSLEAVRAKIRGETLSDQAISAVIDDLAHYRYSDMEIAAFLIGSASF
MTSGELLALTRAMANAGTQLKWPEPVVVDKHCIGGIPGNRTSMVVVPIVAAHGLTIPKTS
SRAITSPAGTADTMEVLARVNVGAEEMKSIVAACNGCVIWGGHVNLSPADDILISVERPL
SLDTREQMVASILSKKLAAGSTHLLLDLPVGPTAKLSSGAEAMRLRKLFEFVGDRFGLNV
EVITTDGRQPIGNGIGPVLEARDVMAVLGNEPGAPADLREKSLRLAAHLLEYDPKLRGGA
GYQRARELLDSGAALKQMQKIIDAQGPTTSRNELGDLAFDVKAGRDGIVSAIDCLRLNRL
ARTAGAPINKGAGIRLFKKIGDRVDQGEPLYRVFTCDPSEHDLAVAAAAADHGYGFADEP
NGHQR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcacgccggtcgcgggcgttgcgccccgaagtgttcagcggcttcagccgggtc
gagctgcgctgcaattcgcgcacgctgttggcgacgctcctgattaccgacgatgatgcc
ctggtcgggccggacgagatcgggctgtcgcaaccggcgctgcggcgcttcgccgagccg
gccggcacattcgcgaccgtctcgccggcgaccccgcctgacagtctggaggcggtgcgc
gccaagatccgcggcgagacattgagcgaccaggcgatctcggccgtcatcgacgacctc
gctcactaccgctattcggacatggagattgcggccttccttattggctcggccagcttc
atgacatcgggcgaactgctggccctgacgcgcgccatggccaatgccggcacccagctg
aaatggcccgagcccgtggtcgtcgacaagcactgcatcggcggcatccccggtaaccgc
acctcgatggtggtggtgccgatcgtcgccgcccacggcctgaccattccgaagacgtcc
tcccgcgcgatcacctccccggccggcaccgctgatacgatggaggtgctggcacgggtc
aatgtcggcgccgaggagatgaaatccatcgtcgccgcctgcaatggctgcgtgatctgg
ggcggccacgtgaatctgtcgccggccgacgacatcctgatttcggtggagcgtccgctc
agcctcgacacccgcgagcagatggtggcctcgatcctgtcgaagaagctcgcggccggc
tccacgcatctgctgctcgatttgccggtcggcccgaccgccaagctcagcagcggcgcg
gaggcgatgcgcctgcgcaagctgttcgagttcgtcggcgatcgcttcggcctcaacgtc
gaggtgatcacgaccgacggccgccaaccgatcggcaatggcatcggcccggtgctggaa
gcgcgcgatgtgatggcggtgctcggcaatgagccgggcgcgccagcggatttgcgcgag
aagtcgctgcggctggcagcgcatctcctcgaatatgatccgaagctgcgcggcggcgcc
ggctatcaacgggcgcgggagttgctcgacagcggcgcggcgctgaagcagatgcaaaag
atcatcgatgcccaggggccgacaacgagccggaacgaactcggcgacctcgccttcgac
gtcaaggccggtcgcgacggcatcgtgtcggcgatcgactgtctgcggctcaatcgcctg
gcgcgcaccgccggcgcaccgatcaacaagggcgccggaatcaggctgttcaagaagatc
ggcgaccgggtcgaccagggtgagccactttaccgcgtgttcacctgcgacccgtccgag
catgatctggcggtggcggcagccgcggccgaccatggttacggcttcgccgacgaaccg
aacggccatcagcgatga

DBGET integrated database retrieval system