KEGG   Bradyrhizobium sp. BTAi1: BBta_3582Help
Entry
BBta_3582         CDS       T00528                                 

Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00010  Glycolysis / Gluconeogenesis
bbt00620  Pyruvate metabolism
bbt00640  Propanoate metabolism
bbt00680  Methane metabolism
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBta_3582
   00620 Pyruvate metabolism
    BBta_3582
   00640 Propanoate metabolism
    BBta_3582
  Energy metabolism
   00680 Methane metabolism
    BBta_3582
Enzymes [BR:bbt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BBta_3582
Lipid biosynthesis proteins [BR:bbt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BBta_3582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABQ35672
RhizoBase: BBta_3582
UniProt: A5EHM8
Position
3742127..3743857
Genome map
AA seq 576 aa AA seqDB search
MTTFKDARAFLLAHRTDYDAAVKGFRWPDPVPFNWALDWFDAELASDPESRERTALWIFD
AAQDRQTKLSFAALSRRSNQVAKFLRAQGLQRGDHLLLLLGNVVPLWETMLAAMKLGVVV
IPATTLLTIDELRDRLERGRAKAVVAAQDQVTKFADLGAGDLVRIVVGAPTTPAGWLPFE
LAAAADETFTPDGPTQPDDPMLLYFTSGTTAKPKLVRHSHRSYPVGHLSTMYWLGLQPGD
VHLNISSPGWAKHAWSCFFSPWNAGATVFVVNQPRFDAKGLLAIIRRCGVTTLCAPPTVW
RLFIQEHLADFKVSLREACGAGEPLNPEVIDQVRAAWGLTIRDGYGQTETAAIVGNSPGQ
TLKIGSMGRPLPGYRVEVADIDGNLASEGEITLALTGERPAGLMQGYQGDDGKLSGADGV
RYRTGDVVFRDEEGYLTFVGRSDDVFKSSDYRISPFELESVLLEHEAVAEAAVVPSPDPI
RLAVPKAYVLLTAGAERSRETALSIFAHLQSRLAPFKRIRRLELVSELPKTISGKIRRVQ
LRRLEHEDNRTDHLRGAEFREEDFPELKSRQAGHEG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattcaaggacgcccgcgcgtttctgctggcgcatcgcaccgattatgatgcg
gccgtgaagggctttcgttggcccgatccggtcccgttcaactgggcgctcgactggttc
gatgccgagctcgcgtccgatccggaaagccgcgagcggaccgcgctgtggatcttcgat
gcggcgcaggaccgccagaccaagctgtcctttgccgcgctgtcgcgccgctccaaccag
gtcgccaaattcctgcgggcgcagggcctgcagcgcggtgatcatctgctgctgctgctc
ggcaatgtcgtgccgctgtgggagacgatgctcgcggcgatgaagctcggcgtcgtcgtg
atccccgcgacgacgcttttgactatcgacgagctgcgcgaccggctagagcgcggccgc
gccaaggccgtcgtcgccgcgcaggatcaggtcacgaagttcgccgatctcggtgccgga
gatctggtccgaatcgtggtcggcgcaccgaccacgccggcgggctggctgccgttcgag
ctggccgctgcggcggacgagacgttcacgccggatgggccgacgcagccggacgatccg
atgctgctgtatttcacctcgggcaccacggccaagccgaagctggtgcgacacagccac
cgcagctatccggtcggccatctctcgacgatgtactggctcggcctgcagccgggcgac
gtccatctcaacatctcctcgccgggctgggccaagcacgcctggagctgcttcttctcg
ccgtggaatgccggcgcgaccgtgttcgtggtcaaccagccgcgctttgacgccaagggg
ctgctcgcgatcatccgccgctgcggcgtcaccacgttgtgcgcgccgcccacggtgtgg
cggctgttcatccaggagcatctcgccgatttcaaggtaagcctgcgcgaggcctgcggc
gccggcgagccgctcaatccggaagtgatcgaccaggtccgtgcggcctgggggctcacc
atccgcgacggctacggccagaccgagaccgccgcgatcgtcggcaactcgccgggccag
acgctgaagatcggttcgatgggccggccgctgccgggctaccgcgtcgaggtcgccgat
atcgacggcaatctcgcgagcgagggcgagatcaccttggcgctcacgggggagcgaccg
gccgggctgatgcagggctatcagggcgacgacggcaagctgtcgggggctgacggggtg
cgctatcgcaccggcgacgtcgtgttccgggacgaggagggctatctcaccttcgtcggc
cgctccgacgacgtgttcaaatcatcggactatcggatctcgccgttcgagctggagagc
gtattgctggagcatgaggcggttgccgaggccgccgtggtgccgtcaccggatccgatc
cggctggcggtccccaaggcctatgtgctgctgacagcgggcgccgagcgctcgcgcgaa
acggcgctgtcgatcttcgcgcatctgcaatcgcggctggcgccgttcaaacgtatccgc
cggctggagctggtcagcgaattgccgaagacgatctcgggcaagatccgccgcgtgcag
ctgcgccggctcgagcacgaggacaaccgcaccgaccatctgcgcggtgcggagttcagg
gaagaggatttcccggagctgaagtctcggcaagccggccacgagggatag

DBGET integrated database retrieval system