KEGG   Bradyrhizobium sp. BTAi1: BBta_3606Help
Entry
BBta_3606         CDS       T00528                                 

Definition
(GenBank) putative exported protein of unknown function
Organism
bbt  Bradyrhizobium sp. BTAi1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
3773861..3775153
Genome map
AA seq 430 aa AA seqDB search
MSTALRRNVSILSLVLASASASAAEVEDLNARLARLERENAAMRMENAALRENKRLREEN
GRLRSAENSEPMRSASSNGAAGSGRLAADRSAAPASLRPGLEARDPYQSYASADGPGAYK
APARPASGVLKIWGEGGAIWSGGDRFFQDAGTALAAFPNTTVSPPLDLTPKVGWEAATGF
DYLIAGSPWHVSGQLRYGQSGQASAQILSSGRLDLGRGRVITASDTFDATYQESRWLADI
AIGRDVFGTGPGALQVKGGLRLLDFETRATNSDLLRQNASIVDVGNVVFTNVDAAQANDG
ANRNSFLGAGPRVGVEGSIPFAGRWSLDYLSDVAVLFGVQRNVVNSRSQSSASVPVLAQP
GTSFTVSTERNTALFNADLQFGLSYWINENVKLGGSYRVDALINTQDTTFTPNRFTHGPR
LTVTGQFDAR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcgcttcgtcgtaacgtctcgatcctcagcctcgtgcttgcatccgcaagc
gcctcggctgcggaggtcgaggatctgaatgcccgactggcaaggctggagcgggagaat
gcagcgatgcggatggagaacgccgcgctgcgcgagaacaagcggctgcgtgaggagaac
ggccggctgcgctcggctgagaactccgagccgatgcgctcggcctcctcgaatggtgca
gccggctcaggacggctggccgcagaccgaagcgcggcgccagcttctctgcgcccggga
ctggaagccagagatccctatcagagctatgcatcggcagatggtcccggcgcctacaag
gcaccggctcgtccggccagcggcgtgctgaagatctggggggaaggcggcgccatctgg
agcggcggcgaccggttcttccaggatgcgggcacggcgctcgctgcatttcccaacacg
accgtgtccccgccgctcgatctgacgcccaaggtcggttgggaggccgccaccggcttc
gactatctgatcgctggctcgccatggcacgtcagcggccagctccgctatggtcagagc
ggccaggccagcgcgcaaatcctgtcgtccggacggcttgatcttggacggggccgcgtc
atcacggcctctgatacgttcgatgcgacctatcaggaatcgcgctggctggccgatatc
gccatcgggcgcgacgtgttcggaaccgggccgggggcgcttcaggtcaagggtggactg
cggctgctcgactttgaaacccgtgcgaccaactccgatctgctgcgacagaatgcgagc
atcgtcgatgtcggcaacgtggtcttcaccaacgtcgatgccgcacaggcgaacgacggc
gcgaatcgcaacagctttctcggcgccggcccgcgtgtcggcgtggaaggctcgatcccg
ttcgccggccgctggtcgctggactatctcagcgacgttgccgtgctgttcggcgttcag
cgcaacgtcgtcaacagcaggtcccagtcgtccgccagcgtgccggtactggcgcaaccc
ggcaccagcttcaccgtctccacggagcgcaacaccgcgctgttcaatgccgatctgcag
ttcggcctgtcatattggatcaacgagaacgtcaagctcggcggaagctaccgggtcgat
gccttgatcaacacgcaggatacgacgttcacgccgaaccgcttcacgcatggcccgcgg
ctgacggtgacgggccagttcgatgcgcgatga

DBGET integrated database retrieval system