KEGG   Bradyrhizobium sp. BTAi1: BBta_3627Help
Entry
BBta_3627         CDS       T00528                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BBta_3627
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BBta_3627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
3793934..3794977
Genome map
AA seq 347 aa AA seqDB search
MKAAVLHAFDEKLTAKEFVRYEEVADPKISRPMDVIVRIGGAGVCRTDLHIVEGIWRSKV
DVKLPYIMGHENAGWVEAVGPGVEGVKVGDSVICHPLVTSGHCLACRRGNDMHALDSSFP
GINANGGYAQYLLTGQRSLIKLPKSLAPKDVAPYTDAGLTAYRAAKKASRHLLPGEYAVV
IGAGGLGHIGIQVLAALCAAEIIVVDRSDKSLELAKTCGAHHLVKADGGEVEAVLALTGG
RGAEAVIDFVGEGDAIAKGLAMTANGGSYYIVGYGGKIDLPTIDMITTEKTIVGNLVGTY
AELVELMALADRGLVNLHTKEYRLSEANDALHDLHHGRIHGRAVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgcggttctccatgcattcgatgaaaagctgacggcgaaggagttcgtcaga
tacgaagaggtcgccgacccgaagatctcgcgtccgatggacgtgattgtgcgcatcggt
ggcgccggagtctgccgtaccgatcttcacatcgtcgagggcatctggcgcagcaaggtc
gacgtcaagcttccctacatcatgggtcatgagaacgcaggctgggtcgaagctgttggc
cctggcgtcgaaggcgtcaaggtcggcgacagcgtgatctgtcacccgctggtgaccagt
ggccattgcctggcgtgtcggcgcggcaacgacatgcacgcgctcgacagctcctttcct
ggcatcaacgccaatggcggctacgcgcaatatctgctgaccggacagcgctcgctgatc
aagctgccaaagtcgctggcgccgaaggacgtcgcgccctacacggacgccggcctgacg
gcctatcgcgcggccaagaaggcgtcgcgtcatctgctgccgggcgaatacgccgtggtg
atcggggccggcggcctcggccatatcggcatccaggttctcgcggcgctgtgtgcggcg
gagatcatcgtcgtcgaccgctccgacaaatcgctggagctcgccaagacctgcggggcg
caccacctggtgaaggccgatggcggcgaggtcgaggcggtgctggcgctgaccggcggt
cgcggcgcggaggccgtcatcgacttcgtcggcgagggcgatgccattgccaagggtctc
gcgatgaccgccaatggcggctcctattacatcgtgggctatggcggcaagatcgatctg
ccgaccatcgacatgatcaccaccgagaagaccatcgtcggcaatctggtcggcacctat
gcggagctggtcgagttgatggcgttggccgaccgcggcctcgtgaacctgcataccaaa
gaataccggctgagcgaggccaatgacgcgctgcatgacctgcatcatgggcgtatccac
ggacgcgccgtgctgatcccgtaa

DBGET integrated database retrieval system