KEGG   Bradyrhizobium sp. BTAi1: BBta_3944Help
Entry
BBta_3944         CDS       T00528                                 

Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bbt  Bradyrhizobium sp. BTAi1
Brite
Enzymes [BR:bbt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BBta_3944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 MTS PrmA RrnaAD ADH_zinc_N Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: ABQ36014
RhizoBase: BBta_3944
UniProt: A5EIM0
Position
4138611..4139270
Genome map
AA seq 219 aa AA seqDB search
MLPFATARQKMVDGQVRTNDVTDHRVLDAMLTVPRENFVPSDRQALAYLDQNLNVSEAGS
AQRFLITPMLTGKLLQAAEIKPTDHVLVVGCATGYLAALAAKLAASVVATDPDPALEGRA
KQLLAGIASVSVRVAPAVQGDPADGRFDVILLNGATEIAVDGLCRQLKEGGRLVGVSAKT
KPARAIIFTRSHGEVGSRTLFDAAAPILPGLEQVPEFVF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctccccttcgcgacggcgcgtcagaaaatggtcgatggccaggtgcgcaccaacgac
gttaccgaccaccgtgtgttggatgcgatgctgacggtgccgcgcgagaacttcgtcccg
tcggaccggcaggcgctggcctatctcgaccagaatctcaacgtgtcggaagccggctcg
gcccagcgcttcctgatcacccccatgctgacgggtaagctgcttcaggccgccgagatc
aagccgaccgatcacgtgctcgtggtcgggtgcgcgacgggctaccttgccgcgcttgcg
gcgaagcttgcggccagcgtggtcgcgaccgatccggacccagctctcgaggggcgcgcc
aagcagctgctggccggcatcgcgagtgtctctgttcgcgtcgcgcctgccgtgcagggc
gatccggccgatggtcgcttcgacgtgattcttctcaacggggcgaccgagatcgcggtc
gatgggctgtgccgccagctcaaggaaggcggtcgcctggtcggcgtctccgcgaagacc
aagccggcccgtgccatcatctttacgcgatcccatggtgaagtgggcagcaggaccctg
ttcgacgctgcggcaccgatccttcctggtctcgagcaggtccccgagttcgttttctaa

DBGET integrated database retrieval system