KEGG   Bradyrhizobium sp. BTAi1: BBta_3973Help
Entry
BBta_3973         CDS       T00528                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
bbt  Bradyrhizobium sp. BTAi1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4179567..4180634)
Genome map
AA seq 355 aa AA seqDB search
MVNALDEHERTIGFGEFALGQIRALRHSANPRNYEIWYVYATGYNTQLNEILNETIARNG
ELSQAELDQLYESYLTHLKTSDRIDKVGARVVGEIDDLVGTISDALGRTASYDASLAGAD
QKLASATSREQLVDIIEALAHSTKQMRETNRMLEQRLTLSKDEISGLQQSLEAIRAESLT
DPLTGLGNRKYFDRMIEMAVEGGLTSNQPLSLLMFDIDHFKSFNDSFGHLTGDQVLRLVG
MSLKNAIKGQDIAARYGGEEFAVVLPNTPLRQALTVADQIRRAVTARELKKKSTGEILGR
VTISVGVSMLRPGDDTDALIERADACLYAAKRSGRNRVICESDPEFAAATRGQVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaatgcgcttgacgaacacgaacgaacgataggctttggcgaatttgcgcttggc
cagatcagagctctgcgtcactcggccaatcctcgcaactacgagatttggtacgtctat
gcgacgggctataacacgcagctgaacgagattctcaacgagacgatcgcgcgcaacggc
gagctttctcaagccgaactcgaccagctctacgaatcctatctgacgcacctgaagacg
tctgatcgcatcgacaaggtcggtgcgcgcgtcgtcggcgagatcgatgacttggtcggc
acgatctccgacgctctcggccgcaccgccagctacgatgcgagccttgccggcgctgac
cagaagcttgcatcggcgacgagccgtgagcagcttgtcgacatcatcgaggctctcgcg
cattcgacgaagcagatgcgggagaccaaccggatgctcgagcagcgtctcacgctgtcc
aaggacgagatcagcggacttcagcagagcctcgaggcgatccgtgccgagagcctgacc
gatccgctcaccggacttggcaatcgcaaatatttcgatcgcatgatcgagatggccgtt
gagggtgggctgacgtcgaatcagccgctctcgctgctgatgttcgacatcgatcacttc
aaatcattcaacgattccttcggtcacctgaccggcgaccaggtgctgcgcctcgtcggg
atgtcgctgaagaatgcgatcaagggacaggatattgcggcgcgctatggcggcgaggag
ttcgcagtggtgctgccgaacacgccgctccgacaggcgctgaccgtcgccgaccagatc
cgccgcgcggtcaccgcgcgggagctcaagaagaagtcgaccggggaaattctcggacgg
gtcacgatctccgtaggcgtttccatgctcaggcccggcgacgacacggatgcgctgatc
gagcgcgcggatgcctgcctctatgccgccaagcgcagcggacgcaatcgcgtgatctgc
gagagcgatccggaattcgccgcggccacgcgcggccaagtggcctga

DBGET integrated database retrieval system