KEGG   Bradyrhizobium sp. BTAi1: BBta_3982Help
Entry
BBta_3982         CDS       T00528                                 

Definition
(GenBank) negative transcriptional regulator
  KO
K07734  
transcriptional regulator
Organism
bbt  Bradyrhizobium sp. BTAi1
Brite
Transcription factors [BR:bbt03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BBta_3982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
4189719..4190369
Genome map
AA seq 216 aa AA seqDB search
MYTPPPFKPDRAASLGFADARGFGTVCAWDGSKPIASLVPFHLGALNDGTPQAFFHVARN
NPLAKVADGATPWLLAVSGADAYVSADWYVSPDQVPTWLYQAVHLTGTARILSEAELARQ
VDEVSAKFEQRLLPKKPWTSDKMTAGRLEAMRKAIVGIVMTIDQVEGSFKLNQHKSEADY
AAIATRLGEQPDIGSQQISSLMRQARPQAFAGETQT
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtatacgccaccgcccttcaagcccgaccgcgccgcgagcctcggcttcgctgacgcg
cgcggcttcggcacggtctgcgcgtgggatggctccaagccgatcgcatctctggtgcca
tttcatctgggcgcgttgaacgacggcacgccgcaggcgttctttcatgtcgcgcgcaac
aatccgctggcaaaggttgccgacggcgcgacgccctggctgctcgccgtcagcggcgcc
gatgcctatgtctcggccgattggtacgtgtcgccagatcaggttccgacctggctctat
caggcggtgcatctgaccggcacggcgcggatcttgtcggaggccgagctcgcgcggcag
gtcgatgaggtcagtgccaagttcgagcagcggctgctgccgaagaagccctggacctcg
gacaagatgacggcgggacgcctcgaggcgatgcgcaaggcgatcgtcggcatcgtcatg
acgatcgaccaggtcgaaggcagcttcaagctcaaccagcacaaatccgaggcggactac
gcggcgatcgcgaccaggctcggcgagcagcccgacatcggctcgcaacagatttcgtct
ctcatgcggcaggcgcggccccaggcctttgccggcgaaacccagacctga

DBGET integrated database retrieval system