KEGG   Bradyrhizobium sp. BTAi1: BBta_4033Help
Entry
BBta_4033         CDS       T00528                                 

Gene name
gloA
Definition
(GenBank) Lactoylglutathione lyase (EC:4.4.1.5)
  KO
K01759  
lactoylglutathione lyase [EC:4.4.1.5]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBta_4033 (gloA)
Enzymes [BR:bbt01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     BBta_4033 (gloA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4233244..4233696)
Genome map
AA seq 150 aa AA seqDB search
MRYLHTMLRVRNLDAALKFYSDALGLKEVRRIDNDKGRFTLVFLCAPEDEHLLKSLPPTR
GAPLVELTYNWDEESYGEDRFFGHLAYEVDDIYATCDRLMKLGITINRPPRDGNMAFVRS
PDLHSIELLQKGEPKAPAEPWLSMPNTGHW
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatctccacaccatgctgcgcgtgcgcaatctcgacgcggcgctcaaattctat
tccgatgcgctcggcctgaaggaggtgcgccggatcgacaacgacaagggacgattcacc
ctggtgtttctctgcgcgcccgaggatgaacacctgctgaagagcctgccgccgacacgc
ggcgcgccgctggtcgagctcacctataattgggacgaggagagctatggcgaggatcgc
ttcttcggccatctcgcttatgaggtcgacgacatctatgccacctgcgatcggctgatg
aagctcggcatcaccatcaaccgtccgccgcgcgacggcaacatggcattcgtccgttcg
cccgatctgcactcgatcgagttgttgcagaagggcgagccgaaggcccctgccgagccc
tggctgtcgatgccgaacaccgggcattggtga

DBGET integrated database retrieval system