KEGG   Bradyrhizobium sp. BTAi1: BBta_4188Help
Entry
BBta_4188         CDS       T00528                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bbt01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bbt00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4398892..4400529)
Genome map
AA seq 545 aa AA seqDB search
MNFQPRGLNDQALQGPASYQAEVEAARALLETHPTWNGVTAEAVARMRLQNRFKTGLDVA
RYTAAVMRADMAAYDEDSTKYTQSLGCWHGFIAQQKLISIKKHFGKTDRRYLYLSGWMIA
ALRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADSRELNDLFRSLDAARKAGDKAKETE
IIARIDGFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQD
GKVTVPHDVFLAKIRACRHAFLELGVEDGIIVTRTDSLGAGLTQQIAFSSQPGDLGDQYN
SFLDCEEVTPGNARNGDVIINRDGKMLRPKRLPSNLYQFRPGTGEDRCVLDCITSLQNGA
DLLWIETEKPHIEQIAKMVDRIRKVIPNAKLAYNNSPSFNWTLNFRWQVYDAMKEAGQDV
SRYNRAELMKAEYDDTPLAKEADERIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLA
REYFGEQGMLGYVKNVQRAEIRQGIACVKHQNMAGSDIGDDHKEYFAGEKALKAGGAHNT
MNQFS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaactttcaaccgcgtggattgaacgaccaagctctccagggccccgcgtcctaccag
gccgaggtcgaggcggcgcgcgcgctgctcgaaacccacccgacatggaacggcgtcacc
gccgaggccgtggcgcgcatgcgcctgcagaaccgcttcaagaccggtctcgacgtggcc
cgctacaccgcggcggtgatgcgcgccgacatggccgcctatgacgaggacagcaccaag
tacacccagtcgctcggctgctggcacggcttcatcgcgcagcagaagctgatctcgatc
aagaagcatttcggcaagaccgaccgccggtacctctatctctcgggctggatgatcgcg
gcgctgcgctcggaattcggcccgctgccggaccagtcgatgcacgagaagacctcggtg
cccgcgctgatcgaggaactctacaccttcctgcgccaggccgactcgcgcgagctcaat
gatctgttccgcagcctcgacgcggcccgcaaggccggcgacaaggcgaaggagacggag
atcatcgccaggatcgacggtttccagacccacgtcgtcccggtgatcgccgacatcgac
gccggcttcggcaatgccgaggcgacctatctcttggccaagaagatgatcgaggcgggc
gcctgcgcgctgcagatcgagaaccaggtctcggacgagaagcagtgcggccatcaggac
ggcaaggtcaccgtgccgcatgacgtgttcctggccaagatccgcgcctgccgccacgcc
ttcctggagctcggcgtcgaggacggcatcatcgtcacccgcaccgactcgctcggcgcc
ggcctcacgcagcagattgccttttcgagccagccgggcgatctcggcgaccagtacaac
agcttcctcgattgcgaggaagtgacgcccgggaacgcccgcaacggcgatgtgatcatc
aaccgcgacggcaagatgctgcgtccgaagcggctgccctccaacctctaccagttccgt
cccggcaccggtgaggaccgttgcgtgctcgactgcatcacctcgctgcagaacggcgcc
gacctcctgtggatcgagaccgagaagccgcatatcgagcagatcgccaagatggtcgac
cgtatccgcaaggtgatcccgaacgccaagctcgcctacaacaattcgccgtcgttcaac
tggaccctcaacttccgttggcaggtctatgacgcgatgaaggaggcgggccaggacgtc
agccgctacaaccgcgccgagctgatgaaggcggagtatgacgacaccccgctggcgaag
gaagccgacgagcgcatccgcaccttccaggcggattcggccaagcgcgccggcatcttc
caccacctcatcaccctgccgacctaccacaccgcggcgctctcgaccgataacctcgcc
cgcgaatatttcggcgagcagggcatgctgggctacgtcaagaacgtccagcgcgccgag
atccgccagggcatcgcctgcgtcaagcatcagaacatggccggctccgacatcggcgac
gaccacaaggaatatttcgccggcgagaaggcgctgaaggccggcggcgcgcacaacacg
atgaaccagttcagctga

DBGET integrated database retrieval system