KEGG   Bradyrhizobium sp. BTAi1: BBta_4322Help
Entry
BBta_4322         CDS       T00528                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BBta_4322
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BBta_4322
Enzymes [BR:bbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BBta_4322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4527569..4528999)
Genome map
AA seq 476 aa AA seqDB search
MLGRIRTAVLWSLALLFIFITFNSNEPYLVRLRGTGHAALLIVGLAAPLLLLLSGRWRHG
LSGRLLVLVWCIPLLALTSTQFTFAWRKYETFDTAPEVARLLGRHFMVGYTSTADAAALA
RQGLIAGIYVTHHNIRGRTAAQLRAEIARLQAERVSAGLPPLLVSADQEGGSVAHLSPAV
PNMPALATLADLPEARRMQRAFEMGQSQGRSLADAGITLNLAPVVDLRPSWTHNRFDFHT
LISRRAISNDPAVVGDIALGYVRGLEASGVRAAVKHFPGLGRVAADTHHFSADLETPAEV
LEQADWRPFRQVLDNSDAAMMVGHVVVDAIDRERPASHSKAVLDGLIRGRWNYQGVIVTD
DLVMGAIYGRDLCKAVVEALSGGADLLLVAYDGTQFYRVLACAKTALAEGRIDLAALRRS
DERLRRWMSREEGPLAANASTGDMAAPTRHRSLADEDTGPTNGASSARTVAGPVAP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgctcgggcgtatcaggacggcagtcctctggagccttgctctgctcttcatcttcatc
acgttcaacagtaacgagccgtatctcgttcggctccgcggcacgggtcacgccgccttg
ctgatcgtcggtctggcggctccgcttctgctcctgctcagcggacgctggcggcacggt
ctctccgggaggctgctcgtcctcgtctggtgcatcccgctgctcgcgctgacatcaacg
caattcacgttcgcctggcgcaagtacgagacgttcgacactgcgcccgaggtcgcgcgg
ctgctcggacggcatttcatggtcggttacacgtcaacggcggatgctgccgcgctggcg
cggcagggcctgatcgccggcatctacgtgacccaccacaacatccgagggcgaaccgct
gctcaacttcgtgctgagatcgcgcggctgcaggccgagcgggtcagcgccggcctgcca
cctctgctggtctcggccgatcaggagggaggctctgtcgcgcacctgtctccggctgtg
ccgaacatgcccgctcttgcgaccttggccgacctgccggaggcgcggcggatgcagcgg
gcgtttgagatgggacagagccagggacggtccctcgcggacgccggtatcaccttgaat
ctcgcgccggtcgtcgatctgcggccgagttggacgcacaacaggttcgatttccacacg
ctgatcagtcggcgcgcgatctccaatgatccggccgtggtcggcgacatcgcgctcggc
tatgtgcgcggtctcgaggccagtggcgttcgcgccgccgtcaagcacttcccaggtctc
gggcgcgttgcggccgacacgcatcatttctcggcagatctcgaaacacctgcggaggtc
ttggaacaggcggattggcggccctttcgacaggtgctcgacaattcggatgcggcgatg
atggtcggccacgtcgtggtcgatgcgatcgaccgcgagcgtccggcatcgcattccaag
gccgtgctcgacggtctgatccggggccgatggaactaccagggcgtgatcgtcaccgac
gacctcgtgatgggcgcgatctacggccgcgatctctgcaaggctgtcgtcgaggctctc
agcggcggcgccgatctgctgctcgtcgcctatgatggcacgcagttctaccgcgtgctg
gcctgcgccaagacggcgctggcggaaggacggatcgatctggcggccctccgcaggagc
gatgagcgtttgcggcgctggatgtcacgggaggaggggcccctggcagcgaatgcctcg
acaggcgacatggccgcgccgacccggcatcgcagcctggccgatgaggacactggtcca
acaaacggcgcgtcgtcagcgcggaccgttgccggtccagtcgcgccatga

DBGET integrated database retrieval system