KEGG   Bradyrhizobium sp. BTAi1: BBta_4420Help
Entry
BBta_4420         CDS       T00528                                 

Definition
(GenBank) putative sugar hydrolase/Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00520  Amino sugar and nucleotide sugar metabolism
bbt01100  Metabolic pathways
bbt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BBta_4420
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BBta_4420
Enzymes [BR:bbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BBta_4420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 HIG_1_N
Motif
Other DBs
NCBI-ProteinID: ABQ36459
RhizoBase: BBta_4420
UniProt: A5EJW5
Position
complement(4631615..4632643)
Genome map
AA seq 342 aa AA seqDB search
MTMRAFITGISGPDLTEAERAFIRAAKPWGFILFKRNVQSPAQVTALVEQLRACAGRAEA
PVLIDQEGGRVQRLGPPHWPVYPAGVVFDRLYDLDSSLGPRAAWLSARLIADDLQQLGIT
VDCLPLADVPVAGADAVIGDRAYGTTPAKVAAIARAVTDGLEQGGVLPVLKHIPGHGRAT
ADTHFRLPTVDTPETELDATDFAAFRPLADLPMAMTAHVVFSAIDAAHPATTSATMIQRV
IRERIGFQGLLMSDDVSMNALAGSIAERTRAIVAAGCDMVLHCNGKLDEMQAVAAETPEL
AGQALLRADRALAARKTPSGFDRIAARAELDALINRLGPASA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgcgggctttcattaccggcatctccggccctgatctcaccgaggccgagcgc
gcgtttatccgcgcggcgaagccctggggcttcatcctgttcaaacgcaatgtccagtca
cctgcgcaagtgactgcactcgttgaacaattgcgtgcttgcgcgggtcgggctgaggcc
cccgttttgatcgaccaagagggcgggcgggtccagcggctggggccgccgcattggccg
gtctatcccgctggtgtcgtcttcgaccgcctctacgaccttgattcgtccctcggcccg
cgtgccgcctggctcagcgcccgcctgatcgccgacgacctgcagcaactcggcatcacc
gtggattgcctgccgctggccgatgtcccggttgccggcgcggacgcggtgatcggcgat
cgggcctatggaacgacgccggccaaggtggcggcgatcgcgcgggcggtgacggatggg
ctggagcagggcggcgtgctgccggtgctcaagcacattcccggtcacggccgggccacc
gccgacacgcatttccggctgccgaccgttgacaccccggaaaccgagctcgacgccacc
gatttcgctgccttccggccgctcgcggatctgccgatggcgatgactgcacatgttgtg
tttagcgcgatcgatgccgcccatccggccacgacttctgcgacaatgatccagcgggtg
attcgcgagcggatcgggttccagggtttgttgatgagtgatgacgtttccatgaacgct
ctggccggatcgatcgccgagcgcacgcgcgcgatcgtcgcggcggggtgcgacatggtt
ctgcattgcaacggcaagctcgacgagatgcaggccgtcgccgccgagacgccagagctg
gctggccaggctttgctccgcgccgatcgcgcgcttgcggcgcgcaagaccccctcgggc
tttgaccggatcgccgcgcgcgccgagctcgacgccctgatcaaccggctgggacccgcg
agcgcatga

DBGET integrated database retrieval system