KEGG   Bradyrhizobium sp. BTAi1: BBta_4460Help
Entry
BBta_4460         CDS       T00528                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00010  Glycolysis / Gluconeogenesis
bbt00020  Citrate cycle (TCA cycle)
bbt00620  Pyruvate metabolism
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01200  Carbon metabolism
Module
bbt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBta_4460 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BBta_4460 (pdhC)
   00620 Pyruvate metabolism
    BBta_4460 (pdhC)
Enzymes [BR:bbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BBta_4460 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ABQ36496
RhizoBase: BBta_4460
UniProt: A5EK02
Position
complement(4671120..4672478)
Genome map
AA seq 452 aa AA seqDB search
MPINILMPALSPTMEKGNLARWLKKEGDQVKSGEVIAEIETDKATMEVEAVDEGTLAKIL
VPEGTQDVPVNDVIAVLAGEGEDVKAAGSAPAAAAPKAETKAAAAAPAAAAAPAAAPAPK
PAAAPAVPAPAAAAAPQLNGHARVFSSPLARRLAKDAGIDLARITGTGPHGRVVARDVEE
AKSGKGLKAAPSAAPAAAGAPALAPSMSDKQILALFEPGSYEVIPHDGMRRTIAQRLTAS
VQNVPHFYLTIDCDIGKLLTAREEINAAAPKDKEKKPLYKLSVNDFVIKAMAVALQKIPN
CNVSWTEGGMVKHKHSDVGVAVAMPGGLITPIIRKAETKTLSAISGEMKDFAARARSRKL
KPEEYQGGTTAVSNLGMYGINHFTAVINPPHATILAVGTSEERPVVRNGKIEIANMMSVT
LSCDHRAIDGALGAELIGAFKQLIENPVMMMV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatattctgatgcccgcgctgtcgccgacgatggagaagggcaacctcgct
cgttggctcaagaaggaaggcgaccaggtcaagtcgggcgaggtcatcgccgagatcgag
accgacaaggccacgatggaggtcgaggcggtcgacgaaggcacgctcgccaagatcctg
gtgccagaaggcacgcaggacgtgccggtcaacgacgtgatcgcggtgctcgccggcgaa
ggcgaggacgtcaaggcggccggcagcgctccggcggccgcggcgcccaaggctgagacc
aaggccgctgcggcggctcccgcggccgcggctgctccggccgccgcgcctgcgccaaag
ccggctgctgctccggctgtgcccgcgccggccgctgccgctgctccgcagttgaacggc
cacgcccgcgtgttctcgtcgccgctggcgcggcgtctcgccaaggacgccggcatcgat
ctcgcgcgtatcaccggcaccggcccgcatggccgcgtcgtggcgcgtgacgtcgaggaa
gcgaagtccggcaagggcctcaaggccgcgccgtcggcggcgcccgccgctgcgggcgca
cccgcgctggcgccgtcgatgtccgacaagcagatcctggcgctgttcgagccgggctcc
tacgaagtcatcccgcatgacggcatgcgccgcaccattgcgcagcgcctgaccgcctcg
gtgcagaacgttccgcacttctatctcacgatcgactgcgacatcggcaagctgctcacc
gcgcgcgaggagatcaatgcggcagctccaaaggacaaggagaagaagccgctctacaag
ctctcggtgaacgacttcgtcatcaaggcgatggcggtggcgctgcagaagattccgaac
tgcaacgtcagctggaccgaaggcggcatggtcaagcacaagcattccgacgtcggcgtc
gccgtcgcgatgccgggcggcctgatcaccccgatcattcgcaaggccgagaccaagacg
ctgtcggcgatctcaggtgagatgaaggacttcgccgcgcgcgcccgctcgcgcaagctg
aagccggaggagtatcagggcggcaccaccgcggtgtccaacctcggcatgtacggcatc
aatcacttcaccgccgtgatcaatccgccgcatgcgaccatcctcgcggtcggcacgtcg
gaagagcggccggtggtacgcaacggcaagatcgagatcgcgaacatgatgagcgtgacc
ctgtcctgcgatcaccgcgcgatcgacggcgcgctcggcgccgagctgatcggcgccttc
aagcagctgatcgaaaatcccgtgatgatgatggtgtga

DBGET integrated database retrieval system