KEGG   Bradyrhizobium sp. BTAi1: BBta_4480Help
Entry
BBta_4480         CDS       T00528                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00010  Glycolysis / Gluconeogenesis
bbt00051  Fructose and mannose metabolism
bbt00562  Inositol phosphate metabolism
bbt00710  Carbon fixation in photosynthetic organisms
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01200  Carbon metabolism
bbt01230  Biosynthesis of amino acids
Module
bbt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bbt_M00002  Glycolysis, core module involving three-carbon compounds
bbt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBta_4480 (tpiA)
   00051 Fructose and mannose metabolism
    BBta_4480 (tpiA)
   00562 Inositol phosphate metabolism
    BBta_4480 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BBta_4480 (tpiA)
Enzymes [BR:bbt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BBta_4480 (tpiA)
Exosome [BR:bbt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBta_4480 (tpiA)
  Exosomal proteins of bladder cancer cells
   BBta_4480 (tpiA)
  Exosomal proteins of melanoma cells
   BBta_4480 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABQ36516
RhizoBase: BBta_4480
UniProt: A5EK22
Position
complement(4691418..4692173)
Genome map
AA seq 251 aa AA seqDB search
MTDHIRPLIAGNWKMNGLKASTAEFEAMLAGAAEVTGKADLLVCPPATLLAGFADKARGT
RAVAVGAQDCHAKASGAHTGDLSAEMLADAGASAIIVGHSERRADHGESDVVVHQKTEAV
WRAGLVAIVCVGETQQQRDAGQTLDILRGQLNLSLPQGSTAANLTVAYEPVWAIGTGLTP
TAKDVEQIHAFIRTLLIERFNGEGARMRILYGGSVKPSNAAELMAVANVNGALVGGASLK
AADFLAIAKGC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacatccggccgctgatcgccggcaactggaaaatgaacggcctgaaggcc
tccaccgccgagttcgaggcgatgctggcgggcgccgccgaagtcaccggcaaggccgat
ctcctggtgtgtccgccggcaaccttgctggccggctttgccgacaaagcgcgtggcacg
agggctgtggccgtcggcgcgcaggattgccacgccaaggcatcgggggcccataccggc
gacctttcagccgagatgctggctgatgccggcgccagtgcgatcatcgtcggccactcc
gaacgtcgcgccgatcatggtgagagcgatgttgtggtgcaccagaagacggaagccgtc
tggcgcgccggcctggttgcgatcgtctgcgtcggcgagacccagcagcagcgcgacgcc
ggtcagaccctggacatcctgcgcggccagctgaacctcagcctgccgcaaggctccacg
gcggccaatctgaccgtggcctatgagccggtttgggcgatcggcaccggcctgaccccg
accgcaaaggatgtcgagcaaatccatgcatttatcaggacgctgctgatcgagcgcttc
aacggcgagggggcgcggatgcgcatcctctatggcggttcggtgaagccgtccaatgcg
gccgagctgatggcggtcgcgaatgtgaatggcgccctggtcggcggcgccagcctcaag
gcggcggattttctcgcaattgcgaaaggatgttga

DBGET integrated database retrieval system