KEGG   Bradyrhizobium sp. BTAi1: BBta_4480Help
Entry
BBta_4480         CDS       T00528                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBta_4480 (tpiA)
   01230 Biosynthesis of amino acids
    BBta_4480 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBta_4480 (tpiA)
   00051 Fructose and mannose metabolism
    BBta_4480 (tpiA)
   00562 Inositol phosphate metabolism
    BBta_4480 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BBta_4480 (tpiA)
Enzymes [BR:bbt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BBta_4480 (tpiA)
Exosome [BR:bbt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBta_4480 (tpiA)
  Exosomal proteins of bladder cancer cells
   BBta_4480 (tpiA)
  Exosomal proteins of melanoma cells
   BBta_4480 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4691418..4692173)
Genome map
AA seq 251 aa AA seqDB search
MTDHIRPLIAGNWKMNGLKASTAEFEAMLAGAAEVTGKADLLVCPPATLLAGFADKARGT
RAVAVGAQDCHAKASGAHTGDLSAEMLADAGASAIIVGHSERRADHGESDVVVHQKTEAV
WRAGLVAIVCVGETQQQRDAGQTLDILRGQLNLSLPQGSTAANLTVAYEPVWAIGTGLTP
TAKDVEQIHAFIRTLLIERFNGEGARMRILYGGSVKPSNAAELMAVANVNGALVGGASLK
AADFLAIAKGC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacatccggccgctgatcgccggcaactggaaaatgaacggcctgaaggcc
tccaccgccgagttcgaggcgatgctggcgggcgccgccgaagtcaccggcaaggccgat
ctcctggtgtgtccgccggcaaccttgctggccggctttgccgacaaagcgcgtggcacg
agggctgtggccgtcggcgcgcaggattgccacgccaaggcatcgggggcccataccggc
gacctttcagccgagatgctggctgatgccggcgccagtgcgatcatcgtcggccactcc
gaacgtcgcgccgatcatggtgagagcgatgttgtggtgcaccagaagacggaagccgtc
tggcgcgccggcctggttgcgatcgtctgcgtcggcgagacccagcagcagcgcgacgcc
ggtcagaccctggacatcctgcgcggccagctgaacctcagcctgccgcaaggctccacg
gcggccaatctgaccgtggcctatgagccggtttgggcgatcggcaccggcctgaccccg
accgcaaaggatgtcgagcaaatccatgcatttatcaggacgctgctgatcgagcgcttc
aacggcgagggggcgcggatgcgcatcctctatggcggttcggtgaagccgtccaatgcg
gccgagctgatggcggtcgcgaatgtgaatggcgccctggtcggcggcgccagcctcaag
gcggcggattttctcgcaattgcgaaaggatgttga

DBGET integrated database retrieval system