KEGG   Bradyrhizobium sp. BTAi1: BBta_4511Help
Entry
BBta_4511         CDS       T00528                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bbt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4725878..4727101)
Genome map
AA seq 407 aa AA seqDB search
MSAVPLRNNKPGRAEVRSITVLGATGSIGESTMDLLRGAPERYRVEALTGNSNVQGLAKL
AREFKPGFVAVADPARLNELRDALAGTGIACGAGESAIIEAAARPADWVMAAVSGAAGLK
PALAAVDRGATVALANKECLVCAGDFFMQRAAQAGACILPADSEHNALFQALSSGNREEL
VRVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEASYL
FALSPDEIDVLVHPQSIVHGMVEFSDRSVVAQLGAPDMRIPIAHCLGWPDRIAGPSARLD
LAKIGTLTFEAPDFVRFPGLRLAYDSLRTGRGATTVYNAANEVAVAAFAAGQIRFGAIAR
LVEATLEHWTRSGNQAPLTSADDAIAIDHDARKTAAGLLPQIAAKAS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagtgccattgcggaacaacaagcctggtcgcgcggaggtgcgcagcatcacc
gtgctcggcgccaccggctcgatcggcgagtcgaccatggacctgttgcgcggcgcgccc
gaacgctatcgggtcgaggcgctgaccggcaacagcaatgtgcaggggctggccaagctc
gctcgcgaattcaagcccggcttcgtggcggtggccgatccggcccggctcaatgagctg
cgcgatgcgctggccggcaccggcatcgcatgcggggcgggggagagcgccatcatcgag
gcggccgcgcgtcccgccgactgggtcatggccgccgtgtccggcgccgccggcctgaaa
cccgctttggccgccgtcgaccgcggcgccacggtggcactcgccaacaaggaatgcctg
gtctgtgcgggcgacttcttcatgcaacgcgccgcgcaggccggcgcctgcatcctgccg
gccgattcggagcacaatgcgctgttccaggcgctgtcctcgggcaatcgcgaggaactg
gtgcgggtcatcatcaccgcgtccggtggtccgttccgaacctgggccgccgccgatatc
gagcaggcgaccctggcgcaggcgctgaagcatccgaactggagcatgggccagaagatc
acgatcgattcggcctccatgatgaacaagggcctcgaagtgatcgaggcgtcctacctg
ttcgcgctgtccccggacgagatcgacgtgctggtgcatccgcagtcgatcgtccacggc
atggtcgagttctcggaccggtcggtggtggcgcagctcggtgcccccgacatgcgcatc
ccgatcgcccattgtctgggctggcctgaccggatcgcgggcccgtcggcccggctggat
ctggccaagatcggcacgctgaccttcgaggcgcccgacttcgtgcggttccccggtctg
cggctggcctatgattcgctccgcaccggccgcggcgccaccacggtgtacaatgcggcc
aacgaggtcgcggtggcggcgtttgccgccgggcagatccgcttcggcgcgatcgcccgg
ctggtcgaggccacgcttgagcattggacacgatccggtaatcaggcacctctaacatcg
gcggacgacgcgatcgccattgaccatgatgcgcgaaaaaccgccgcggggctcttgcct
caaatcgccgcaaaagcatcttaa

DBGET integrated database retrieval system