KEGG   Bradyrhizobium sp. BTAi1: BBta_4958Help
Entry
BBta_4958         CDS       T00528                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bbt  Bradyrhizobium sp. BTAi1
Brite
Enzymes [BR:bbt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BBta_4958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
5196354..5197262
Genome map
AA seq 302 aa AA seqDB search
MDQIAKARRWYAEDLRCKTPIRRNPHIVEAFGAVPREAFVGPGPWWIIPYPYREPFITPD
DDPRWLYHDVLVSIDPSRKLNNGMPSFWARNFEHLDIARGERVLQIGAGSGYYSAVLAEM
VGRAGRVTAVEVDAALAARAHANLNSWPQVQVISGDGRDVHADASDHDVVIVFAGCTHPA
PQWLDGLADNGRLLLPLTSEDWSGFLLRVVRRGASFEATSIGGVSIFPCTNGRDENASRR
LKSALENLTMMNVPIQALHRGTPSSTESERVWYQAPGLWLERQGSEVDAATQQAEGGSSD
TA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagatcgcaaaagcacgccgctggtatgccgaggacctacgctgcaagacgcct
attcggcgcaacccacacatcgtcgaggccttcggcgctgtcccgcgagaggcgttcgtc
ggcccaggtccttggtggatcataccctacccctaccgggagccattcatcaccccggac
gacgatccgcgttggctctatcacgacgtcctggtctcgatcgacccgagccggaaactc
aacaatgggatgccgagcttttgggcgcgcaatttcgagcacctcgatatcgcccgaggt
gaacgagtgctgcagatcggagcgggcagcggctactattcagccgtgctcgccgagatg
gtcgggcgcgccgggcgggtgacggcggtcgaagtcgacgcggctctcgccgctcgagct
cacgccaacctcaacagctggccgcaggtccaggtgatctcgggcgacggccgagatgtc
catgccgacgcgagcgaccatgacgtcgtgatcgtgttcgcaggctgcacgcaccccgct
ccgcaatggctggatggcctcgccgacaacggccggctgctgctcccgctgaccagcgaa
gattggtccggcttcctgctgcgcgtggtccgccgcggtgcttccttcgaggccacgtca
atcggcggggtcagcatctttccctgcacaaacggccgcgatgagaacgccagtcgccgg
ctgaagagtgccctcgaaaatttgacgatgatgaatgttccaatccaagcactccaccgc
ggcactccatcatccaccgagtccgagcgggtctggtatcaagcacctggtctctggcta
gagcgacaagggtccgaggtcgatgcggccacacagcaggccgaaggcggcagcagcgac
accgcctga

DBGET integrated database retrieval system