KEGG   Bradyrhizobium sp. BTAi1: BBta_5624Help
Entry
BBta_5624         CDS       T00528                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bbt00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(5859903..5861873)
Genome map
AA seq 656 aa AA seqDB search
MCGIAGLFRPGGADDSALAGIVGRMTAALAHRGPDASGSWVSGRQGIALGQRRLAILDLS
EAGAQPMHSACGRYTITFNGEIYNHLDLRAELEDAAAAPNWRGHSDTETLLAAIRQWGLV
PALQRLIGMFAFALWDAETRQLILARDRFGEKPLFYGWSGADLVFGSELKALAAHPGWAP
SLDRAALTDFMRYSYVPAPATIWRDVRKLPPASFVAFVADAGPGTSPTAQSYWSLRDTVV
AAQGDRISGESEAIARLEQLLSTAVKRQCLSDVPLGAFLSGGVDSSTIVALMQAQASQPV
RTFSIGFAEGGYNEAEDARKVAQHLGTDHTELYVDARTAMEVVPKLPRIYDEPFADSSQI
PTHLVAQLARRHVTVALSGDAGDELFGGYNRHVWGSALQARLGRVPMPLRRAIGAALGAI
APEPADTLLNMLQPVLPARLRVRHAGDQVAKLARIVAADGFDGLYRTLCSIDQDPRATVV
AGEERASWAASEMKQLRGQISLLDRMTLADSLSYLSDDILQKVDRAAMAVALETRVPFLD
RDVVEFSTRVPASMKVRDGRGKWLVRQVLYRHVPADMIDRPKTGFSIPLDAWLRGPLKSW
AGDLLSPARLKRQGLFAPTRVTRMFEEHLSRRHNHAYWLWNVLMAEAWYDEWGRAG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatagccggcctgttcagaccgggaggggcggacgacagcgcgctggccggg
attgtcgggcggatgacagccgcgctggcgcatcgcggtcccgatgcgtccggcagctgg
gtcagcggccggcagggcattgcgttgggacagcggcgccttgcgattctcgatctgtcg
gaggccggcgcgcagccgatgcacagtgcttgcggccgctatacgatcaccttcaacggc
gaaatctacaatcatctcgatctgcgtgccgagctcgaggacgccgccgccgcgccgaac
tggcgtggccattccgacaccgaaacgctgctcgccgccatcagacaatggggtctcgtc
ccggcgctgcagcgcctgatcgggatgtttgccttcgcgttgtgggacgctgaaacgagg
cagctgatcctggcgcgggatcggttcggcgagaagccgctgttctatggctggagcggc
gccgacctggtgttcggctccgagctcaaggcgctcgcggcccatcccggatgggcaccg
tcgctagatcgggccgcgctcaccgatttcatgcgctattcttacgtgccggcgccggct
accatctggcgcgacgtgcgcaaattgccacccgcttctttcgttgccttcgtcgccgac
gctggacctgggacgtcgcccaccgcgcaatcctattggtcgctgcgtgataccgtcgtc
gccgcccaaggtgatcggatcagcggcgaaagcgaggcgatcgcgcggctggagcagctg
ttgtcgacggcggtgaagcggcagtgcctgtcggatgtgccgctcggcgccttcctgtcc
ggcggcgtcgactcctcgaccatcgtggcgctgatgcaggcgcaggcgagccagcccgtt
cgcaccttcagcatcggctttgccgagggcggttacaacgaggccgaggacgcgcgcaaa
gtcgcgcagcatctcggcaccgatcataccgagctctatgttgatgcgcggaccgcgatg
gaggtggtgccgaagctgccgcggatttacgacgagccgttcgccgattcctcgcagatc
ccgacccatcttgtggcgcagctggcgcgccggcacgtcaccgtcgcgctgtcgggcgat
gcgggtgacgagctgttcggcggctacaacaggcatgtctggggtagcgcgctgcaggcg
cgtctcggtcgcgtgccgatgccgttgcggcgggcgatcggagccgcgctcggcgccatc
gctccggagccggccgatacgctgctcaatatgttgcagccggtgttgcccgcccggctc
agggtccggcatgctggtgatcaggtcgccaagctcgcccgcatcgtcgccgccgacggc
ttcgatggcctgtatcggacgctgtgctcgatcgaccaggatccgcgcgcgacggtcgtc
gcgggcgaggagcgggcgagctgggctgcgagcgagatgaaacagctgagggggcagata
agcctgctcgatcgcatgacgctggcggattccctgagctatctgagcgatgacatcctg
cagaaggtggatcgtgccgcgatggccgtggcattggagacgcgcgtgcccttcctcgac
agggatgtcgtcgaattctcgacccgggtgcctgcgagcatgaaggtccgcgacggtcgt
ggcaaatggctcgtccgacaggtcctgtatcgccatgttcctgctgacatgatcgaccgg
ccgaagaccggtttcagcattccgctcgatgcctggctgcgcgggccgctgaaatcatgg
gccggcgatttgctgtcacccgcacgactgaagcggcagggcctgttcgctcccacgcgc
gtgacgcgcatgttcgaagagcatctcagccgccgtcacaatcatgcgtactggctctgg
aacgtgctgatggccgaggcctggtacgacgaatggggccgcgccggatag

DBGET integrated database retrieval system