KEGG   Bradyrhizobium sp. BTAi1: BBta_5755Help
Entry
BBta_5755         CDS       T00528                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BBta_5755
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBta_5755
  Lipid metabolism
   00071 Fatty acid degradation
    BBta_5755
  Amino acid metabolism
   00350 Tyrosine metabolism
    BBta_5755
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBta_5755
   00626 Naphthalene degradation
    BBta_5755
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BBta_5755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
6009164..6010153
Genome map
AA seq 329 aa AA seqDB search
MHAMVLQSPGAPLRHECLSDPEPGLGEIRVRVSACGVCRTDLHLCDGELPSIPYPIIPGH
EIVGRVDRIGRGVTNHRLGERVGIPWLGHTCGRCPFCSRGMENLCDEPSFTGYTRNGGYA
THAIADANYAFPLDGLGDDVATAPLLCAGLIGWRSLVMAGDAERLGIYGFGAAGHIIAQV
ARWQGRQIYAFTREHDRPAQDLARQLGAVWAAGADQRPDVDLDAAIIYAPAGELVPAALR
AVRKGGRVVCAGIHMSDIPSFPYSLLWGERRVMSVANLTRQDGVDFLRVAQEADIRTHTT
AYSLSEANTVLARLRQGDIVGAAVLVPDF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgcgatggtgctgcaatcgcctggagcccctctccggcatgaatgtctgtcggat
cccgagccgggtctcggagaaattcgcgtccgtgtcagcgcctgcggagtctgccgaacc
gacctgcatctctgcgatggcgagctccccagcattccttatccgatcattcccgggcac
gagattgttggtcgcgttgaccgaatcggtcgtggggtgacaaaccaccggttgggcgag
cgggtcggaattccgtggctggggcatacctgcggccgctgccccttctgcagccgcgga
atggaaaatctctgcgacgagccttctttcaccggctatacgcgcaatggcggttatgcg
acccacgccatcgccgacgcaaattatgcctttccgctcgatggactgggcgatgacgtc
gcgaccgcgcccctgctgtgcgccggtctcatcggctggcggtcactggtcatggcgggt
gacgcagaacggctcggaatctacgggtttggagctgcgggtcacatcattgcccaggtc
gcccgctggcagggtcgccagatctatgccttcacccgcgaacatgaccggcccgcacaa
gatctggcccgccaacttggcgcagtatgggctgcaggtgcagaccagcgtccagacgtc
gatctggacgctgccatcatctacgcccctgccggcgagctcgttccggccgctttgcgg
gctgtccgcaaaggcggccgggttgtctgcgccggcattcatatgagcgacattccgagc
ttcccttattcgcttctgtggggagaacgccgggtgatgtccgtcgccaatctgacgcgg
caggatggtgtcgattttctacgggtggcccaggaggctgacatccgcacgcatacgacg
gcctactccttgtccgaagcaaacactgttctggcccgcttgaggcagggcgacatcgtg
ggtgcggccgtcctcgtcccggacttttga

DBGET integrated database retrieval system