KEGG   Bradyrhizobium sp. BTAi1: BBta_5755Help
Entry
BBta_5755         CDS       T00528                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00010  Glycolysis / Gluconeogenesis
bbt00071  Fatty acid degradation
bbt00350  Tyrosine metabolism
bbt00625  Chloroalkane and chloroalkene degradation
bbt00626  Naphthalene degradation
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBta_5755
  Lipid metabolism
   00071 Fatty acid degradation
    BBta_5755
  Amino acid metabolism
   00350 Tyrosine metabolism
    BBta_5755
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBta_5755
   00626 Naphthalene degradation
    BBta_5755
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BBta_5755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABQ37706
RhizoBase: BBta_5755
UniProt: A5ENG2
Position
6009164..6010153
Genome map
AA seq 329 aa AA seqDB search
MHAMVLQSPGAPLRHECLSDPEPGLGEIRVRVSACGVCRTDLHLCDGELPSIPYPIIPGH
EIVGRVDRIGRGVTNHRLGERVGIPWLGHTCGRCPFCSRGMENLCDEPSFTGYTRNGGYA
THAIADANYAFPLDGLGDDVATAPLLCAGLIGWRSLVMAGDAERLGIYGFGAAGHIIAQV
ARWQGRQIYAFTREHDRPAQDLARQLGAVWAAGADQRPDVDLDAAIIYAPAGELVPAALR
AVRKGGRVVCAGIHMSDIPSFPYSLLWGERRVMSVANLTRQDGVDFLRVAQEADIRTHTT
AYSLSEANTVLARLRQGDIVGAAVLVPDF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgcgatggtgctgcaatcgcctggagcccctctccggcatgaatgtctgtcggat
cccgagccgggtctcggagaaattcgcgtccgtgtcagcgcctgcggagtctgccgaacc
gacctgcatctctgcgatggcgagctccccagcattccttatccgatcattcccgggcac
gagattgttggtcgcgttgaccgaatcggtcgtggggtgacaaaccaccggttgggcgag
cgggtcggaattccgtggctggggcatacctgcggccgctgccccttctgcagccgcgga
atggaaaatctctgcgacgagccttctttcaccggctatacgcgcaatggcggttatgcg
acccacgccatcgccgacgcaaattatgcctttccgctcgatggactgggcgatgacgtc
gcgaccgcgcccctgctgtgcgccggtctcatcggctggcggtcactggtcatggcgggt
gacgcagaacggctcggaatctacgggtttggagctgcgggtcacatcattgcccaggtc
gcccgctggcagggtcgccagatctatgccttcacccgcgaacatgaccggcccgcacaa
gatctggcccgccaacttggcgcagtatgggctgcaggtgcagaccagcgtccagacgtc
gatctggacgctgccatcatctacgcccctgccggcgagctcgttccggccgctttgcgg
gctgtccgcaaaggcggccgggttgtctgcgccggcattcatatgagcgacattccgagc
ttcccttattcgcttctgtggggagaacgccgggtgatgtccgtcgccaatctgacgcgg
caggatggtgtcgattttctacgggtggcccaggaggctgacatccgcacgcatacgacg
gcctactccttgtccgaagcaaacactgttctggcccgcttgaggcagggcgacatcgtg
ggtgcggccgtcctcgtcccggacttttga

DBGET integrated database retrieval system