KEGG   Bradyrhizobium sp. BTAi1: BBta_5811Help
Entry
BBta_5811         CDS       T00528                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00220  Arginine biosynthesis
bbt00330  Arginine and proline metabolism
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01130  Biosynthesis of antibiotics
bbt01230  Biosynthesis of amino acids
Module
bbt_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BBta_5811
   00330 Arginine and proline metabolism
    BBta_5811
Enzymes [BR:bbt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BBta_5811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABQ37756
RhizoBase: BBta_5811
UniProt: A5ENL2
Position
complement(6058735..6059709)
Genome map
AA seq 324 aa AA seqDB search
MTHVDKASPSRVAVLGAPIDLGASVRGTLMGPAALRTAGLVPLLESLGLDVTDYGDVGIA
DMTDLSDDPPAKAKHYRQIQRWSRVLARRSHELAHTGAIPVFLGGDHSLSMGSVNGVARH
CRDVGQELFVLWLDAHADYNTPETTITANMHGMSAAFLCGEPGLDGLLGGDVRATIPTEH
LELFGIRSIDKAEKELLRMRRISVADMRAIDEFGVGVLTRRILDKVRARNGVLHVSFDVD
FLDPEVAPGVGTTVPGGATYREAHLIMELLHDSGLVRSVDIVELNPFLDERGKTARVAVE
LIGSLFGQQITDRPTPTNAIVPDL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgacccacgttgacaaagcatctccaagccgcgtcgccgtactgggggcgccgatcgat
ctcggcgcatctgtgcgcggcaccctgatggggccggctgcgcttcgaaccgccgggctc
gtgccgctgctggaaagcctcggtctcgatgtgacggattatggcgacgttgggatcgcc
gatatgaccgacctcagcgatgaccctcctgcgaaggcgaagcattatcgccagatccaa
cgctggtcgcgggtgctggcacgtcggagccatgaactggcgcacaccggggcgatcccg
gtgttcttgggaggagatcactcgctgtcgatgggatcggtgaacggtgtcgcgcgtcac
tgccgcgacgtcggtcaggagttgttcgtgctctggctcgatgcgcatgccgactacaac
acgccggagaccacgatcacggccaacatgcatggcatgtccgcggccttcctgtgtgga
gagccgggccttgatggcttgctcggtggcgacgtccgcgccaccatccccaccgagcac
ctcgaactgttcggcatccgctcgatcgacaaggcggagaaggagctgctgcgcatgcgt
cgcatcagcgtcgccgacatgcgcgccatcgacgagtttggcgtcggcgtcctgacgcgc
aggatcctcgacaaggtccgcgctcgcaatggtgttctgcatgtcagcttcgacgtcgat
tttctcgatccggaggtggcgccaggggtcggcacgacagttcctggcggagcgacctat
cgcgaggcgcatctcatcatggagttgctgcatgattccggcctggtgcggtcggtcgac
atcgtcgagctcaacccctttctcgacgagcgtggcaagacggcccgggtcgcggtcgaa
ctgatcggcagcctgtttggccagcagatcaccgatcggccgacaccgaccaacgcgatc
gtcccggatctatga

DBGET integrated database retrieval system