KEGG   Bradyrhizobium sp. BTAi1: BBta_5811Help
Entry
BBta_5811         CDS       T00528                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbt01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bbt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(6058735..6059709)
Genome map
AA seq 324 aa AA seqDB search
MTHVDKASPSRVAVLGAPIDLGASVRGTLMGPAALRTAGLVPLLESLGLDVTDYGDVGIA
DMTDLSDDPPAKAKHYRQIQRWSRVLARRSHELAHTGAIPVFLGGDHSLSMGSVNGVARH
CRDVGQELFVLWLDAHADYNTPETTITANMHGMSAAFLCGEPGLDGLLGGDVRATIPTEH
LELFGIRSIDKAEKELLRMRRISVADMRAIDEFGVGVLTRRILDKVRARNGVLHVSFDVD
FLDPEVAPGVGTTVPGGATYREAHLIMELLHDSGLVRSVDIVELNPFLDERGKTARVAVE
LIGSLFGQQITDRPTPTNAIVPDL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgacccacgttgacaaagcatctccaagccgcgtcgccgtactgggggcgccgatcgat
ctcggcgcatctgtgcgcggcaccctgatggggccggctgcgcttcgaaccgccgggctc
gtgccgctgctggaaagcctcggtctcgatgtgacggattatggcgacgttgggatcgcc
gatatgaccgacctcagcgatgaccctcctgcgaaggcgaagcattatcgccagatccaa
cgctggtcgcgggtgctggcacgtcggagccatgaactggcgcacaccggggcgatcccg
gtgttcttgggaggagatcactcgctgtcgatgggatcggtgaacggtgtcgcgcgtcac
tgccgcgacgtcggtcaggagttgttcgtgctctggctcgatgcgcatgccgactacaac
acgccggagaccacgatcacggccaacatgcatggcatgtccgcggccttcctgtgtgga
gagccgggccttgatggcttgctcggtggcgacgtccgcgccaccatccccaccgagcac
ctcgaactgttcggcatccgctcgatcgacaaggcggagaaggagctgctgcgcatgcgt
cgcatcagcgtcgccgacatgcgcgccatcgacgagtttggcgtcggcgtcctgacgcgc
aggatcctcgacaaggtccgcgctcgcaatggtgttctgcatgtcagcttcgacgtcgat
tttctcgatccggaggtggcgccaggggtcggcacgacagttcctggcggagcgacctat
cgcgaggcgcatctcatcatggagttgctgcatgattccggcctggtgcggtcggtcgac
atcgtcgagctcaacccctttctcgacgagcgtggcaagacggcccgggtcgcggtcgaa
ctgatcggcagcctgtttggccagcagatcaccgatcggccgacaccgaccaacgcgatc
gtcccggatctatga

DBGET integrated database retrieval system