KEGG   Bradyrhizobium sp. BTAi1: BBta_6145Help
Entry
BBta_6145         CDS       T00528                                 

Definition
(GenBank) putative NAD dependent epimerase/dehydratase family protein
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bbt  Bradyrhizobium sp. BTAi1
Brite
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     BBta_6145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 Polysacc_synt_2 RmlD_sub_bind NmrA adh_short KR UDPG_MGDP_dh_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABQ38070
RhizoBase: BBta_6145
UniProt: A5EPH6
Position
6373449..6374474
Genome map
AA seq 341 aa AA seqDB search
MKVLVTGGSGFIGHHLVSALAARGTEVRVLDIRCPTHMIDEVEYIEGSVLDAGLVRNAVA
GVDQVYHLAGLPGMWMPDREDFYRVNCVGTENVLAAARASRIRRFLHCSTESILFDYPGS
MGAAAAETAPPAEAMPGAYTRSKALAEARAMAAAAEGFPVVVGTPTMPIGPHDSNLTPPS
AMLRHFLDSRVQLYLDFIVNLVDVRDVAAGLILAMERGKVGGRYVFGGESLRLSRILELM
AAISGRKHVAISVPGRLAELSAGLLEFVSDHLTKQTPSGTAEGVRIARSASDLSIDRAKR
ELGYAPRPIEPTLRETIAFLLDSEPGKRLDEKQHPFRTAAE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcctcgtcaccggcggcagcggttttatcggacaccaccttgtctctgcgctg
gcagcgcggggcaccgaggtccgcgtgctcgacatccgttgcccgacccacatgatcgac
gaggtggagtatattgagggctcggtgctcgatgccggcctggtgcgcaacgccgtcgcg
ggcgtcgaccaagtctaccatctggccgggctgccgggcatgtggatgccggaccgcgag
gatttctaccgcgtcaactgcgtcggcacagaaaacgttctggcagcagcgcgcgccagc
cgtatccgccggttcctgcactgctcgaccgaatcgattcttttcgactatccgggttcg
atgggggctgcggcggctgagacggcaccgccggccgaggccatgccaggggcctatacc
cgctccaaggcgcttgccgaggcgcgggccatggccgccgccgccgagggcttcccggtg
gtggtgggcacgccgacgatgccgatcggaccgcacgacagcaacctgacgcccccctcg
gcgatgctgcgccatttcctggacagccgggttcagctctacctcgatttcatcgtcaac
ctggtcgatgtgcgggacgttgccgctggcctgatcctcgccatggagcgcggcaaggtt
ggcggccgctatgtgttcggtggcgagagcctgcggctcagccggattctcgaactgatg
gctgcgatcagcggccgcaagcacgtcgccatctcggtcccgggccggctggccgagctg
tccgccggcctgctcgaattcgtctccgatcacctcaccaagcagactccctccggcacc
gccgaaggcgtgcggatcgcgcggtcggcctccgacctgtcgatcgaccgggccaagcgc
gagctcggctacgcgccccgcccgatcgagcccactttgcgcgagacgatcgcctttttg
ctcgattccgagccgggcaagcggctcgacgagaaacaacacccttttcgcacggcggcc
gaatag

DBGET integrated database retrieval system