KEGG   Bradyrhizobium sp. BTAi1: BBta_6145Help
Entry
BBta_6145         CDS       T00528                                 

Definition
NAD dependent epimerase/dehydratase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bbt  Bradyrhizobium sp. BTAi1
Brite
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BBta_6145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
6373449..6374474
Genome map
AA seq 341 aa AA seqDB search
MKVLVTGGSGFIGHHLVSALAARGTEVRVLDIRCPTHMIDEVEYIEGSVLDAGLVRNAVA
GVDQVYHLAGLPGMWMPDREDFYRVNCVGTENVLAAARASRIRRFLHCSTESILFDYPGS
MGAAAAETAPPAEAMPGAYTRSKALAEARAMAAAAEGFPVVVGTPTMPIGPHDSNLTPPS
AMLRHFLDSRVQLYLDFIVNLVDVRDVAAGLILAMERGKVGGRYVFGGESLRLSRILELM
AAISGRKHVAISVPGRLAELSAGLLEFVSDHLTKQTPSGTAEGVRIARSASDLSIDRAKR
ELGYAPRPIEPTLRETIAFLLDSEPGKRLDEKQHPFRTAAE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcctcgtcaccggcggcagcggttttatcggacaccaccttgtctctgcgctg
gcagcgcggggcaccgaggtccgcgtgctcgacatccgttgcccgacccacatgatcgac
gaggtggagtatattgagggctcggtgctcgatgccggcctggtgcgcaacgccgtcgcg
ggcgtcgaccaagtctaccatctggccgggctgccgggcatgtggatgccggaccgcgag
gatttctaccgcgtcaactgcgtcggcacagaaaacgttctggcagcagcgcgcgccagc
cgtatccgccggttcctgcactgctcgaccgaatcgattcttttcgactatccgggttcg
atgggggctgcggcggctgagacggcaccgccggccgaggccatgccaggggcctatacc
cgctccaaggcgcttgccgaggcgcgggccatggccgccgccgccgagggcttcccggtg
gtggtgggcacgccgacgatgccgatcggaccgcacgacagcaacctgacgcccccctcg
gcgatgctgcgccatttcctggacagccgggttcagctctacctcgatttcatcgtcaac
ctggtcgatgtgcgggacgttgccgctggcctgatcctcgccatggagcgcggcaaggtt
ggcggccgctatgtgttcggtggcgagagcctgcggctcagccggattctcgaactgatg
gctgcgatcagcggccgcaagcacgtcgccatctcggtcccgggccggctggccgagctg
tccgccggcctgctcgaattcgtctccgatcacctcaccaagcagactccctccggcacc
gccgaaggcgtgcggatcgcgcggtcggcctccgacctgtcgatcgaccgggccaagcgc
gagctcggctacgcgccccgcccgatcgagcccactttgcgcgagacgatcgcctttttg
ctcgattccgagccgggcaagcggctcgacgagaaacaacacccttttcgcacggcggcc
gaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system