KEGG   Bradyrhizobium sp. BTAi1: BBta_6295Help
Entry
BBta_6295         CDS       T00528                                 

Gene name
gpx
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00480  Glutathione metabolism
bbt00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BBta_6295 (gpx)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BBta_6295 (gpx)
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BBta_6295 (gpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABQ38213
RhizoBase: BBta_6295
UniProt: A5EPW9
Position
complement(6541921..6542409)
Genome map
AA seq 162 aa AA seqDB search
MASPTASIYDFTAASLTGEEVPLKRFAGQVLLIVNTASACGFTPQYRGLEALHRAYADRG
FAVLGFPCNQFGAQEPGTAEEIGAFCSTKYDVTFPLFAKIDVNGAEAHPLYKFLKGEKTG
LLGSAIKWNFTKFLVDRQGNVVSRHAPTTTPEALKKEIEALL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtccaacggccagcatctacgatttcaccgccgcctcgctcacgggcgaggag
gtgccgctgaagcgcttcgcgggacaggtgctcctgatcgtcaacaccgcgagcgcgtgc
ggcttcacgccgcaatatcgcggcctggaggcgttgcaccgcgcctatgcggacaggggc
tttgccgtgctcggatttccctgtaaccagttcggcgcccaggagcccggcacggccgag
gagatcggtgcgttctgctcgacgaagtacgatgtcaccttcccgctgtttgcgaagatc
gacgtcaacggcgcggaggcgcatccgctctacaagttcctgaagggcgagaagaccggc
ctcttgggctcggcgatcaaatggaatttcaccaaattcctggtcgatcgccaaggcaat
gtggtgtcgcgccatgcgccgaccaccacgcccgaggcgttgaagaaagagatcgaggca
ctgctgtga

DBGET integrated database retrieval system