KEGG   Bradyrhizobium sp. BTAi1: BBta_6323Help
Entry
BBta_6323         CDS       T00528                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00500  Starch and sucrose metabolism
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
Module
bbt_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBta_6323 (glgB)
Enzymes [BR:bbt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BBta_6323 (glgB)
Exosome [BR:bbt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBta_6323 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ABQ38241
RhizoBase: BBta_6323
UniProt: A5EPZ7
Position
6580859..6582997
Genome map
AA seq 712 aa AA seqDB search
MTHLSPEAFAIIEGRHADPFRYLGQHDVDGRTVIRAFLPEASRVEAVGDNGEVAPLARIH
DAGLFTGTMSGPQRYRLRATFGDHVTDLEDPYRFLPILTDFDLHLLGEGNHERLYDKLGA
HPMVLDGVDGVGFVVLAPNARRVSVVGDFNFWNARRHPMRVRGNGYWELFIPRAKAGDHY
KFDIIGPQGEHLPLKSDPMAFAAEMRPKTASIVVDETRLPRPRPAPSDINKLDRPVSIYE
VHLGSWRRKDNNQWLTYRELAEQLPAYARDMGFTHIEFLPVSEHPFDGSWGYQPTGLFAP
TSRFGSPEDFCALVDACHREGLAVWLDWVPGHFPDDPHGLGHFDGTALYEHANPMQGRHL
DWGTLIYNYGRTEVANFLRSNALFWLERYGIDGLRVDAVASMLYLDYSRPSGGWIPNKYG
GRENLEAIEFLRRTNIEVFGHFPQATTAAEESTAWPQVSRPVDIGGLGFGYKWNMGWMHD
TLRYVGKDPIHRKYHHGEILFGLHYAFSENFILPLSHDEVVHGKRSILGRMPGDDWQRFA
NLRAYYSFMFGHPGKKLLFMGCEIAQEREWNHDSSLDWHLLGDAKYAGIQALIRDLNHLY
RNQPALHERDCEPEGFDWLITEDADRNVFAWVRKGFDERARCVVVVNFSPNVYYNYRVRV
PLGGTWREVFNSDSSHYGGSNVGNVGQVHASEDQQLNLILPPMAAVFLVPEA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgacccatctttctcccgaggcgtttgcgatcatcgaaggtcggcatgccgacccgttt
cgctatctcggtcaacacgacgtcgacggccggaccgtgatccgcgcgttcctgcccgag
gcctcgcgcgtcgaggccgtcggagacaatggcgaggtggcaccgcttgcacggatccat
gacgccggcctgttcaccgggaccatgtcggggccgcagcgctatcggctgcgggcgacg
ttcggcgatcacgtcaccgacctcgaggacccctatcgcttcctgccgatcctgaccgat
ttcgacctgcatctgctcggcgaaggcaaccacgagcggctctacgacaagctcggcgcc
cacccgatggtgctcgacggcgtcgacggggtgggcttcgtggtgctggcgccgaacgcg
cgccgtgtcagcgtggtcggcgatttcaacttctggaatgcgcggcgtcacccgatgcgg
gtgcggggcaacggctattgggagctgttcattccccgagccaaagccggggatcactac
aagttcgacattatcggcccgcagggcgagcacctgccgctgaaatcggacccgatggcg
ttcgcggccgagatgcgtcccaagacggcatccatcgttgtcgacgaaacgcgcctgccg
cgaccgcggccggccccctcggacatcaacaagctggacaggccggtttcgatctacgag
gtgcatctcgggtcctggcggcgcaaggacaacaaccaatggctcacctatcgcgagctg
gccgagcagttgccggcctatgcgcgagacatgggttttacgcatatcgaatttctgccg
gtcagcgagcacccgttcgacggctcctggggctatcagccgaccggcctgttcgccccg
accagccgcttcggcagcccggaggatttctgtgccctggtggacgcctgccaccgcgag
ggactggcggtctggctggactgggtgcccggacatttccccgatgatccgcacggcctc
ggccatttcgacggcacggcgctgtacgagcacgccaacccgatgcagggccgccatctc
gattggggcaccctgatctacaattacggccgcaccgaagtggccaatttcctgcgctcg
aacgcgctgttctggctggagcgctacggcatcgacggcttgcgcgtcgacgccgtcgcc
tcgatgctctatctcgactacagccgtccgtccggcggctggatcccgaacaagtatggc
gggcgggagaacctggaggcgatcgagtttctgcggcgaaccaatatcgaggtgttcggc
catttcccgcaggcgaccacggccgccgaggaatcgaccgcctggccgcaggtgtcgcgc
ccggtcgacatcggcgggctcggtttcggctacaagtggaacatgggctggatgcacgac
accttgcgctatgtcggcaaggatccgatccaccgcaaatatcaccacggcgagatcctg
ttcggcctgcactacgccttttcagaaaacttcatcctgccgctgtcgcatgacgaggtc
gtgcacggcaagcgctcgatcctcggccgcatgcccggcgacgattggcaacgcttcgcc
aatctgcgcgcctattacagcttcatgttcggacatccgggcaagaagctgttgttcatg
ggctgcgagatcgcccaggagcgcgagtggaatcacgattcctcgctcgattggcacctg
ctcggcgacgcaaaatatgccggcatccaggcgctgatccgcgacctcaaccatctctat
cgcaatcagcccgctttgcatgagcgggattgcgagccggaggggtttgactggctgatc
acggaagatgccgaccgcaatgtcttcgcctgggtgagaaagggcttcgatgagcgggct
cgctgcgtcgtggtcgtgaacttttcgcccaacgtgtattacaattaccgggtccgcgtg
ccgctcggcggcacatggcgggaagtcttcaattccgactcctcgcattatggcggcagc
aatgtcggcaacgtcggccaggtccatgcctctgaagatcaacagctcaacctcatcctc
ccgcccatggcagcggtatttctcgtcccggaagcctga

DBGET integrated database retrieval system