KEGG   Bradyrhizobium sp. BTAi1: BBta_6323Help
Entry
BBta_6323         CDS       T00528                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bbt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
6580859..6582997
Genome map
AA seq 712 aa AA seqDB search
MTHLSPEAFAIIEGRHADPFRYLGQHDVDGRTVIRAFLPEASRVEAVGDNGEVAPLARIH
DAGLFTGTMSGPQRYRLRATFGDHVTDLEDPYRFLPILTDFDLHLLGEGNHERLYDKLGA
HPMVLDGVDGVGFVVLAPNARRVSVVGDFNFWNARRHPMRVRGNGYWELFIPRAKAGDHY
KFDIIGPQGEHLPLKSDPMAFAAEMRPKTASIVVDETRLPRPRPAPSDINKLDRPVSIYE
VHLGSWRRKDNNQWLTYRELAEQLPAYARDMGFTHIEFLPVSEHPFDGSWGYQPTGLFAP
TSRFGSPEDFCALVDACHREGLAVWLDWVPGHFPDDPHGLGHFDGTALYEHANPMQGRHL
DWGTLIYNYGRTEVANFLRSNALFWLERYGIDGLRVDAVASMLYLDYSRPSGGWIPNKYG
GRENLEAIEFLRRTNIEVFGHFPQATTAAEESTAWPQVSRPVDIGGLGFGYKWNMGWMHD
TLRYVGKDPIHRKYHHGEILFGLHYAFSENFILPLSHDEVVHGKRSILGRMPGDDWQRFA
NLRAYYSFMFGHPGKKLLFMGCEIAQEREWNHDSSLDWHLLGDAKYAGIQALIRDLNHLY
RNQPALHERDCEPEGFDWLITEDADRNVFAWVRKGFDERARCVVVVNFSPNVYYNYRVRV
PLGGTWREVFNSDSSHYGGSNVGNVGQVHASEDQQLNLILPPMAAVFLVPEA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgacccatctttctcccgaggcgtttgcgatcatcgaaggtcggcatgccgacccgttt
cgctatctcggtcaacacgacgtcgacggccggaccgtgatccgcgcgttcctgcccgag
gcctcgcgcgtcgaggccgtcggagacaatggcgaggtggcaccgcttgcacggatccat
gacgccggcctgttcaccgggaccatgtcggggccgcagcgctatcggctgcgggcgacg
ttcggcgatcacgtcaccgacctcgaggacccctatcgcttcctgccgatcctgaccgat
ttcgacctgcatctgctcggcgaaggcaaccacgagcggctctacgacaagctcggcgcc
cacccgatggtgctcgacggcgtcgacggggtgggcttcgtggtgctggcgccgaacgcg
cgccgtgtcagcgtggtcggcgatttcaacttctggaatgcgcggcgtcacccgatgcgg
gtgcggggcaacggctattgggagctgttcattccccgagccaaagccggggatcactac
aagttcgacattatcggcccgcagggcgagcacctgccgctgaaatcggacccgatggcg
ttcgcggccgagatgcgtcccaagacggcatccatcgttgtcgacgaaacgcgcctgccg
cgaccgcggccggccccctcggacatcaacaagctggacaggccggtttcgatctacgag
gtgcatctcgggtcctggcggcgcaaggacaacaaccaatggctcacctatcgcgagctg
gccgagcagttgccggcctatgcgcgagacatgggttttacgcatatcgaatttctgccg
gtcagcgagcacccgttcgacggctcctggggctatcagccgaccggcctgttcgccccg
accagccgcttcggcagcccggaggatttctgtgccctggtggacgcctgccaccgcgag
ggactggcggtctggctggactgggtgcccggacatttccccgatgatccgcacggcctc
ggccatttcgacggcacggcgctgtacgagcacgccaacccgatgcagggccgccatctc
gattggggcaccctgatctacaattacggccgcaccgaagtggccaatttcctgcgctcg
aacgcgctgttctggctggagcgctacggcatcgacggcttgcgcgtcgacgccgtcgcc
tcgatgctctatctcgactacagccgtccgtccggcggctggatcccgaacaagtatggc
gggcgggagaacctggaggcgatcgagtttctgcggcgaaccaatatcgaggtgttcggc
catttcccgcaggcgaccacggccgccgaggaatcgaccgcctggccgcaggtgtcgcgc
ccggtcgacatcggcgggctcggtttcggctacaagtggaacatgggctggatgcacgac
accttgcgctatgtcggcaaggatccgatccaccgcaaatatcaccacggcgagatcctg
ttcggcctgcactacgccttttcagaaaacttcatcctgccgctgtcgcatgacgaggtc
gtgcacggcaagcgctcgatcctcggccgcatgcccggcgacgattggcaacgcttcgcc
aatctgcgcgcctattacagcttcatgttcggacatccgggcaagaagctgttgttcatg
ggctgcgagatcgcccaggagcgcgagtggaatcacgattcctcgctcgattggcacctg
ctcggcgacgcaaaatatgccggcatccaggcgctgatccgcgacctcaaccatctctat
cgcaatcagcccgctttgcatgagcgggattgcgagccggaggggtttgactggctgatc
acggaagatgccgaccgcaatgtcttcgcctgggtgagaaagggcttcgatgagcgggct
cgctgcgtcgtggtcgtgaacttttcgcccaacgtgtattacaattaccgggtccgcgtg
ccgctcggcggcacatggcgggaagtcttcaattccgactcctcgcattatggcggcagc
aatgtcggcaacgtcggccaggtccatgcctctgaagatcaacagctcaacctcatcctc
ccgcccatggcagcggtatttctcgtcccggaagcctga

DBGET integrated database retrieval system