KEGG   Bradyrhizobium sp. BTAi1: BBta_6426Help
Entry
BBta_6426         CDS       T00528                                 

Gene name
cycA
Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BBta_6426 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BBta_6426 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(6694745..6695179)
Genome map
AA seq 144 aa AA seqDB search
MLRAGVVAMALTVTSAGAGFALDGGDPAKGEQIFKQCMTCHRIGPDAKNAVGPVLTGVVG
RATGTYPGFAYSDLNKHAGEAGLVWTEDNIFEYLPDPSAFLKKYLTEKGKADQAAGSTKM
VFKLANEQQRKDVIAYLKTFSEKK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgctcagagcgggtgtggttgcgatggctcttacggtaacatctgctggtgccggcttt
gcgctcgacggcggtgacccggcgaaaggcgaacagatcttcaaacaatgcatgacctgc
catcgcatcggacccgacgcgaagaacgctgtcggcccggtgctgaccggcgtcgtcggg
cgcgccaccgggacgtatccaggctttgcctattcggacctcaacaagcacgctggcgag
gccggcctggtctggaccgaggacaatatcttcgagtacctccccgaccccagcgccttt
ctcaagaagtatctgaccgagaagggcaaggcggaccaggccgccggctccaccaagatg
gtgttcaagctcgccaacgagcagcagcgcaaggacgtcatcgcctatctgaagacgttc
tccgagaagaagtga

DBGET integrated database retrieval system